KEGG   Equus caballus (horse): 100073295Help
Entry
100073295         CDS       T01058                                 

Definition
(RefSeq) histone H2B subacrosomal variant
  KO
K11252  histone H2B
Organism
ecb  Equus caballus (horse)
Pathway
ecb05034  Alcoholism
ecb05203  Viral carcinogenesis
ecb05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100073295
  Immune diseases
   05322 Systemic lupus erythematosus
    100073295
  Substance dependence
   05034 Alcoholism
    100073295
Chromosome and associated proteins [BR:ecb03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100073295
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100073295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF
Motif
Other DBs
NCBI-GeneID: 100073295
NCBI-ProteinID: XP_001504072
Position
14
AA seq 122 aa AA seqDB search
MARDSTKKSRCSRRRQSPASRKKSHASTYRGHRNYSLYINRVLKEVVPQRGISARTLDTM
NILINNIFERISTEACSMMYFRNRCTLTPQDVQKAVYSLFPGKLAKYAVAFGSEAVQRYL
HS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggccagagattccaccaagaagagcaggtgctccagacgacgccaaagcccagcctcc
agaaagaaatcacacgccagcacctaccgtggccacagaaattactcactctacataaac
agggtcctaaaggaagtggttccccagaggggcatatcggctcgcaccttggacaccatg
aacatcttgatcaacaacatcttcgagcgcatttctacggaagcctgcagcatgatgtat
ttcagaaatcggtgtaccctcacccctcaagatgtccagaaggcagtgtactcgctgttt
cctgggaaactagctaagtatgcagtggcttttggaagtgaagctgtccagagatatctt
cactcctaa

DBGET integrated database retrieval system