KEGG   Equus caballus (horse): 100146145Help
Entry
100146145         CDS       T01058                                 

Gene name
GPX2
Definition
glutathione peroxidase 2 (gastrointestinal) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ecb  Equus caballus (horse)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100146145 (GPX2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100146145 (GPX2)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    100146145 (GPX2)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100146145 (GPX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
24
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAISLDGEKIDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFTLVQKCEVNGQNQHPVFAYLK
DKLPYPYDDPLSLMTDPKFIIWSPVCRSDVSWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacattgctaagtccttctacgaccttagtgctatcagcctggatggggagaag
atagatttcaatacattccgaggcagggcggtgctgattgagaatgtggcctcgctctga
ggcacaactacccgggacttcacccagctcaacgagctgcagtgccgctttcccaggcgc
ctggtggttctcggcttcccgtgcaaccaatttggacatcaggagaactgtcagaatgag
gagatcctgaacagtctcaagtatgtccgccctgggggtggattccagcccacctttacc
cttgtccaaaagtgtgaagtgaatggtcagaaccagcatcctgtcttcgcctacctgaag
gacaagctcccctacccttatgatgacccactttcccttatgaccgatcccaagttcatc
atttggagcccggtgtgccgctcagatgtgtcctggaactttgagaagttccttattggg
ccagagggggagcccttccgacgctacagccgcaccttccccaccatcaacattgagcct
gacatcaagcgcctcctcaaagttgccatatag

DBGET integrated database retrieval system