KEGG   Equus caballus (horse): 100146391Help
Entry
100146391         CDS       T01058                                 

Definition
cytochrome P450 2D14-like
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100146391
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100146391
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100146391
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100146391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
28
AA seq 501 aa AA seqDB search
MGLLTGETLGTLAVAVAIFLLLVDLMHRRQRWAPRYPPGPMPLPGLGNLLQVDFQNPHCC
FTPLRRRFGDVFSLQLAWTPVVVLNGLAAIREALVHRGEDTSDRPRVPVMEHLGFGPHAE
GVIFAQRGHIWREQRRFSVSTLRNFGMGKKSLEQWVTEEASCLCAAFADQAGRPFSPNAL
LNKAVSNVIASLTFGRRFEYNNDPCFLKILDLMEGFLKEASGFVPQVLSAIPVLLHIPGL
VAKVFPGQRAFMAQLDELVAEHRMTRDPAQPPRDLTDAFQDEVQKAKGNPESSFNDDNLR
LVVSDLFFAGMVTTSTTLAWALLLMILHPDVQRRVQQEVDEVIGQARRPEMGDQAHMPFT
MAVVHEVQRFADITPLGVPHMTSRDIEVQGFLIPRGTTLITNLSSVLKDETVWKKPFRFH
PEHFLDAQGRFVKQEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPAGQPRPS
DHGVFGSMVTPSPYQLCAVPR
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgaccggggagacactggggacgctggccgtggccgtggccatcttcctg
ctcctggtggacctgatgcaccggcgccaacgctgggccccccgctaccccccaggcccc
atgcccctgcctgggctgggcaacctgctgcaggtggacttccagaacccgcactgctgc
tttactccgctgcggcgccgcttcggggacgtgttcagcctgcagctggcctggacgccc
gtggtcgtgctcaacgggctggcggccattcgcgaggcgctggtgcaccgcggcgaggac
acctccgaccgcccacgtgtgccggtgatggagcacctgggtttcgggccgcacgcggaa
ggggtgatctttgcccaacgtgggcacatctggcgggagcagcggcgcttctccgtgtcc
accctgcgcaactttggcatgggcaagaagtccctggagcagtgggtgaccgaggaggcc
tcgtgcctctgtgccgccttcgccgaccaggccggacggccgtttagccccaacgccctc
ctgaataaagcggtgagcaacgtgatcgcctccctgaccttcgggcgccgcttcgagtac
aacaacgacccgtgcttcctcaagatattggacctaatggagggctttctgaaagaggcg
tcaggcttcgtgccccaggtgctgagtgcgatccccgtgctcctgcacatcccggggctg
gtcgccaaggtctttcctgggcagagggccttcatggcccagttggatgagctggttgct
gagcacaggatgacccgggacccggcccagcctccccgagacctgactgacgccttccag
gacgaggtgcagaaggccaaggggaacccagagagcagcttcaatgatgacaacctgcgc
ctggtggtgtctgacctgttctttgccgggatggtgaccacctcgaccacgctggcctgg
gccctcctgctcatgatcctgcacccggatgtgcagcgccgtgtccaacaggaggtcgat
gaggtgatagggcaggcgcggcgaccagagatgggggaccaggcccacatgcccttcacc
atggccgtggtccacgaggttcagcgctttgcggacatcaccccactgggtgtaccccac
atgacatcccgtgacattgaagtgcagggcttcctcatccccagggggaccacgctcatc
accaacctgtcatcggtgctgaaggacgagaccgtctggaagaagcccttccgcttccac
cccgagcacttcctggacgcccagggccgcttcgtcaagcaggaggccttcatgcccttc
tcagcaggccgccgctcgtgcctcggggagcccctggcccgcatggagctcttcctcttc
ttcacctgcctcctgcagcgcttcagcttctcggtgcccgctgggcagccccgccccagc
gaccacggtgtctttggctccatggtaaccccatccccctaccagctctgtgctgtgccc
cgctag

DBGET integrated database retrieval system