KEGG   Equus caballus (horse): 100146413Help
Entry
100146413         CDS       T01058                                 

Definition
cytochrome P450 2A13-like
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100146413
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100146413
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100146413
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100146413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
10
AA seq 494 aa AA seqDB search
MLASGLLLVAFLACLTLMVLMSVWRQGKFLGKLPPGPTPLPFIGNYLQLNTEQMYNSLMK
ISKRYGPVFTVHLGPRRIVVLCGYEAVKEALLDQAEEFSGRGEQATFDWLFKGYGVAFSN
GERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIEAFRSTRGTLIDPTFFLSRAVSN
VISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFYSVMKHLPGPQQQAFKE
LQGLEDFIAKKVEQNQRTLDPNSPRNFIDSFLIRMQQEQKNPNTEFYLKNLVLTTLNVFF
AGTETVSTTLRYGFLLLMKHPDVEAKVHEEVDRVIGKNRQPKFEDRAKMPYTEAVIHEIQ
RFGDMIPMGVARRVTKDTKFRDFLLPKGTEVFPMLGSVLRDPRFFSNPHDFNPQHFLDEK
GQFKKSDGFVPFSIGKRYCFGEGLARMELFLFLTTIMQNFHFKSPQSPQDIDVSPKHVGF
ATIPRNYTMSFQPR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgcttctggtggcttttctggcctgcctgaccttaatggtcttg
atgtctgtctggcggcaggggaagttcttggggaagctgcctcctggacccaccccattg
cctttcattgggaactacctgcagctgaacacagagcagatgtacaactccctcatgaag
atcagcaagcgctatgggccagtgttcacggttcacctggggccccggcgaatcgtggtg
ctatgtggatacgaagctgtgaaggaggctctgttggaccaggctgaggaattcagtgga
cgaggagagcaggccaccttcgactggctcttcaaaggctatggtgtggcattcagcaac
ggcgagcgtgccaaacagctcagacgcttctccatcactacactgcgggacttcggagtg
ggcaagcgtggcattgaggaacgcattcaggaggaagcaggcttcctcatcgaggccttc
cggagcacacgtggtaccttgattgatcccaccttcttcctgagccgagctgtctccaat
gtcatcagctccattgtctttggggatcgctttgactatgaagacaaagagttcctgtca
ctgctgcgtatgatgctgggaagcttccaatttacagctacgtctacggggcagctctat
gagatgttctactcagtgatgaaacacctgccagggccacagcaacaggcctttaaggag
ctgcagggcctggaggacttcatagccaagaaggtggagcagaaccaacgcaccctggat
cccaactccccgcggaacttcatcgactccttcctcatccgcatgcagcaggagcagaag
aaccccaacacagagttctacttgaagaacctggtgctgaccacgttgaatgtcttcttt
gctggcacagagacagtcagcacaacactacgctatggcttcctgctgctcatgaagcac
ccagatgtggaggccaaggtccatgaggaggttgaccgggtgattggcaagaaccgtcag
cccaagtttgaggaccgggccaaaatgccctacacagaggcggtgattcacgagatccaa
agatttggagacatgatcccaatgggcgtggcccgcagagtcaccaaggacaccaaattt
cgagactttctcctcccaaagggcactgaagtgttccctatgctgggctctgtcctgaga
gaccccaggttcttctccaatccccacgatttcaacccccagcacttcctggatgagaag
gggcagtttaagaagagtgatgggttcgtgcccttctccattggaaagcggtactgtttt
ggagaaggcctggctaggatggagctctttctattcctcactaccatcatgcagaacttc
cacttcaaatccccgcaatcacctcaagacatcgacgtgtcccccaaacatgtgggcttt
gccactatcccacgaaactacaccatgagcttccagccccgctag

DBGET integrated database retrieval system