KEGG   Equus caballus (horse): 100146423Help
Entry
100146423         CDS       T01058                                 

Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
ecb  Equus caballus (horse)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100146423
   00350 Tyrosine metabolism
    100146423
   00380 Tryptophan metabolism
    100146423
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100146423
   00760 Nicotinate and nicotinamide metabolism
    100146423
   00830 Retinol metabolism
    100146423
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100146423
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100146423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
18
AA seq 1344 aa AA seqDB search
MPHLSRSDELVFFVNGRKVLERNADPEVTLLTFLRKNLRLTGTKYVCGRGGCGACTVMVS
KHDPVSRKIRHFSVTACLVPICSLYGAAVTTVEGVGSIKTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPILESGRTFCAESSGCQQKGRG
KCCLDQGENAASSLGRESDICTELFAKDEFQPLDPTQELIFPPELLRMAENPEKRTLTFH
GERVTWISPGTLKDLLELKVKHPDAPLILGNTSLGPAKKSQGHFHPVLLSPARISELSMV
STTSEGLTIGAGCSLAQVKDILAGRVSELPEEKTQTYRALLKHLKRLAGQQIRNMASLGG
HIMSRHCYSDLNPVLAVGNTALNLMSKEGTRQIPLDRDFLAGLASADLKPEEILESVYIP
HSQRWEFVSAFRQAQCQQNALADVTAGMRVLFQEGTDTIEDLSLAYGGVGDATISAQKSC
QQLLGRRWNEPMLDEACRLLLDEVSLPGGAPGGSVEFKRTLVVSFFFKFYLEVLQELKKP
GKLLSVPDGHHFPEISDRFLSALEDFPATVPQGVQRYQSVDSHQALQDPVGRPIMHLSGL
KHATGEAIFCDDIPTVDKELFMALVTSTRAHAKIISVDLSKALELPGVVDVITAEDIPGT
NGAEDDKLLAVDKVLCVGQIVCAVVAETEAQAKRAVEETKIAYEDLEPIIFTIEDAIKHS
SFLCPEKKLEQGNVEKAFEEVDQIVEEVHVGGQEHFYMETQRVLVIPKTEDKELDIYVST
QDPAHVQKTVSSTLNIPINRITCHVKRVGGGFGGKVGRPAVLGAIAAVGANKTGYPIRLV
LDREDDMLITGGRHPLFGKYNVGFMNSGRIRALDIECFINGGCTLDDSELVTEFLILKME
NAYKIRNLRFRGRACMTNLPSNTAFRGFGFPQGTLVTESCITAVAAKCGLLPEKVREKNM
YKTVDKTIYKQAFNPEPLIRCWNECLDKSSFHSRRMQVAEFNKKNYWRKRGLAVVPMKFS
VGFAATSFHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKVPMSHMHICET
STATVPNTIATAASIGSDVNGRAVQNACQILLKRLEPIIKKNPEGTWEDWIEAAFEQRIN
LSATGYFRGYEAFMDWEKGEGDPFPYYVYGAASSEVEVDCLTGAHKKIRTDIVMDACCSL
NPAIDIGQIEGSFTQGMGLYTTEELKYSPEGVLYSRGPDDYKIPTITDVPEEFNVSLLPS
SQTPLTIYSSKGLGESGMFLGSSVFFAIADAVATARRERDIAEDFTVRSPATPERVRMAC
ADRFTEMIPRDDPKTFKPWSIPIA
NT seq 4035 nt NT seq  +upstreamnt  +downstreamnt
atgccccacctgtcgagatccgacgagttggttttcttcgtgaacgggaggaaggtgctg
gagaggaacgcagacccggaagtcacactgctgaccttcctacgaaagaacttacgcctc
acgggaaccaagtatgtctgcggaagaggaggctgtggggcctgcaccgtgatggtgtcg
aagcacgaccccgtgtccaggaagataagacacttctccgtcactgcgtgcctggtgccc
atctgctctctgtatggagctgctgtcaccaccgtggaaggtgttggaagcatcaaaacc
aggcttcacccggtgcaggagaggattgccaagagccacggcacccagtgcgggttctgc
acccctgggatggtgatgtccatgtacacgctgctcaggaaccacccacagccctctgag
gagcagctcatggaagccctgggaggcaacctttgccgctgcactgggtatcggccaatt
ctcgagagtgggaggaccttctgtgcggagtcaagtggctgtcagcagaaaggaagagga
aaatgctgcttggaccagggagaaaatgccgcttcctcgcttggcagggaaagtgacatt
tgcacagagttgtttgcgaaagacgagttccagcccttggaccctacccaggagctcata
tttcccccagaactcttgagaatggcggagaacccagaaaagcgaacgctgacctttcat
ggagagagggttacctggatctcccccgggaccctcaaggatctcctggagctgaaagtg
aaacaccccgacgcccctctcatcctgggcaacacctcactgggacctgcaaagaaatct
caaggacattttcacccagttctcctctctcctgctaggatttctgagctgagtatggtg
tccacaacaagcgaggggctgacgataggtgctggctgcagtctggcccaggtgaaggac
atcttggctgggagggtttccgagctcccagaggagaaaactcagacgtaccgagccctc
ctgaagcacctgaagaggctggcaggccagcagatccggaatatggcatccttaggggga
catatcatgagccggcactgctattcggatctgaatccagttctggctgtgggcaacacc
gccctcaatctgatgtccaaagaagggacacggcagattcctctagacagagattttctt
gctgggttggcaagtgcagaccttaagccagaggaaattttggagtcggtgtacatccct
cactctcaaaggtgggaatttgtgtcagccttccgacaggctcagtgccagcagaatgcc
ttggccgacgtgacggctggcatgcgagtcctcttccaagaaggcacggacaccattgag
gacctgagcctggcttacggaggggttggggatgccacaatcagtgcacagaaatcctgc
cagcagctcctgggcaggcgctggaatgagccgatgctggatgaggcttgcaggctgctc
ctggacgaagtctccctcccaggcggggctccggggggcagtgtggaattcaagaggact
ctggtggtcagcttctttttcaagttctacctggaggttctgcaggaactgaagaagccg
ggcaagctgctctctgtgcccgatggccatcattttcctgaaatttcagaccgattccta
agcgctctagaagatttcccggccacagtaccccagggcgtccaaaggtaccagagtgtg
gactctcaccaagccctccaggatccagtcggacggcccatcatgcacctgtcaggtctc
aaacatgccacaggtgaagccatattttgcgatgacatccccacggtggataaagaactt
ttcatggctttggtgaccagtaccagagcccatgcaaaaatcatatcagttgatttgtcc
aaggcccttgaactccccggggtggttgatgtgataacagctgaggacattccaggcacc
aatggtgccgaagatgacaaattgttggctgtagataaggtgctgtgcgtgggccagatc
gtctgtgctgtggttgcagagacggaggcacaggcgaagcgtgcagtggaagagacaaag
atcgcctatgaggacctggagcccataatcttcaccatcgaggatgccataaaacacagc
tcgttcctgtgccctgaaaaaaagcttgaacaaggaaacgtcgagaaggcatttgaagaa
gtcgatcaaattgtggaagaggtccacgttggaggacaggaacatttttacatggaaaca
cagcgagtgctcgttattccaaagacagaggacaaagaactggacatttatgtgtcgaca
caggatccagcccacgtgcagaaaacagtgtcctctacgttaaacatccccatcaacagg
atcacctgtcatgtaaagcgagtgggtggaggttttggcgggaaggtgggaagaccagct
gtactcggggctattgcagctgtgggcgcaaacaaaactggttaccccattcgtcttgtt
cttgatcgtgaagatgatatgttaataactgggggaagacacccattatttggaaaatat
aacgtgggattcatgaacagcgggcgcatcagagctctcgacatcgagtgcttcattaac
ggaggctgcacgctggatgactcagagctggtaactgaatttcttatactaaagatggaa
aatgcgtataaaatccgcaacctcaggttccggggacgtgcgtgcatgacaaatttacca
tccaacacggcctttcgtggattcggcttcccccaaggaaccctggtcacagagtcttgc
atcacagccgtggcagccaaatgtggccttctgccagaaaaggtgagggagaaaaacatg
tacaaaacagttgataaaaccatctacaaacaagcgttcaaccctgagcccctgataaga
tgctggaacgaatgtctggacaagtcttcctttcacagccgaaggatgcaagtggcagag
ttcaacaagaagaattactggaggaagagaggcctggctgtggtccccatgaagttttcc
gttggctttgctgccacaagctttcatcaggcagccgcactggttcacatctacacagat
gggtccgtactggtcacacatggaggcaacgaactgggccaaggcattcacaccaaaatg
ctacaggtggccagccgtgagttgaaggtccccatgtctcacatgcacatctgtgaaaca
agcacagccacggtgcctaacaccatcgcgacagcggcgtccatcggctccgacgtcaac
ggccgagctgtgcagaatgcttgccagatcctgctgaaacgccttgagcccatcattaag
aaaaatccggaaggtacttgggaagactggatagaagctgcttttgaacaaagaatcaat
ctttcagccactggatacttcaggggctatgaggccttcatggactgggagaagggggag
ggagacccgtttccctactacgtctacggagcagccagctctgaggtggaagtggactgc
ctgacgggagctcacaagaaaatcagaacagacatcgtcatggatgcatgctgcagccta
aatccagccattgatattgggcagattgaaggctcatttacccagggaatgggcctttat
accaccgaggagctgaaatattccccagaaggagtcttgtattcccgaggcccagacgat
tacaaaattcccaccatcactgacgtcccagaggagttcaatgtgtccttgttgccgtca
tcgcaaaccccactaaccatctattcatccaagggcctgggtgagtctgggatgtttctg
gggtcatctgtgttcttcgccatcgctgatgctgtggccacagcacgcagagaaagagac
atcgccgaggacttcacggtgcggagcccagcaacgccagaacgggttcgaatggcctgc
gccgaccgcttcacagagatgatcccaagagacgaccccaagacatttaaaccttggtct
atccctatagcataa

DBGET integrated database retrieval system