KEGG   Equus caballus (horse): 100146509Help
Entry
100146509         CDS       T01058                                 

Gene name
COMT
Definition
catechol-O-methyltransferase (EC:2.1.1.6)
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ecb  Equus caballus (horse)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100146509 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100146509 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    100146509 (COMT)
Enzymes [BR:ecb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     100146509 (COMT)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100146509 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 269 aa AA seqDB search
MLEPTPMLLAAFSLGLALLPLLFFLRRWGWLLIGWNECILQPIHNLLMGDSKEQRILRHV
LQHAVAGDPQSVLETIDAYCSQKEWAMNVGDKKGQFLDAVVQEQQPSVLLELGAYCGYSA
VRMARLLPPGARLLTIEINPDYAAITQRMLDFAGLQDRVTVVLGASQDIIPQLKKKYDVD
TLDVVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVIVPGAPDFLAHVRGSGRFECTH
FSSYLEYSLWVVDGVEKAVYLGPGSPAQP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctagagccaacacccatgctgttggcagccttctcattgggcctggcactgctgcct
ctgctcttcttcctgcgacgctggggctggctcctcatcggctggaacgagtgcatccta
cagcccatccacaacctgctcatgggtgacagcaaggagcagcgcattctgcgccatgtg
ctgcagcacgcggtggccggggacccgcagagcgtgctggagaccattgacgcctactgc
tcgcagaaggaatgggccatgaacgtgggcgacaagaaaggccagttcctggatgcagtg
gtgcaggagcagcagccgtctgtgctgctggagctgggggcctactgcggctactcggcc
gtgcgcatggcccgcctgctgccgcccggcgcccgtctgctcaccatcgagatcaaccct
gactatgccgccatcacccagcggatgctggacttcgcgggcctgcaggacagggtaacc
gttgtcctcggggcctcccaggacatcatcccccagctgaagaagaaatatgacgtggac
acgctggacgtggtcttcctcgaccactggaaggaccggtacctgccggacacgctcctc
ctggaggagtgtggcctgttacgcaaggggacggtgttgctggctgacaatgtcatcgtc
ccaggagcaccggatttcctggcccacgtgcgcgggagcggccgctttgagtgcacgcac
ttctcctcatacctggagtactctctgtgggtggtggatggcgtggagaaggccgtctac
ctgggcccgggcagcccagcacagccttga

DBGET integrated database retrieval system