KEGG   Equus caballus (horse): 100146641Help
Entry
100146641         CDS       T01058                                 

Gene name
NEU4
Definition
sialidase 4
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
ecb  Equus caballus (horse)
Pathway
Other glycan degradation
Sphingolipid metabolism
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ecb00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ecb00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 470 aa AA seqDB search
MGIASGNLLVKAQIWDQRHASSRTKHTCGHTAQRKNTSPGNLEGLGQQGRVPEGARSGSL
LFAGHGDTALVTETQTHGQCFEDGPREPGRGGGNTLSEHDARTYTVFLFFIACXGRTSET
AQIGGGTNAEQICCVTSRDPGRSCHGARDLTAEAVGGAEQDWATFAVGPGHGIQLRSGRL
LVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWHHGGVVPNLRSGECQLAVVDGEQ
ASGILYCNARSPLGSRVQALSTDEGTSFLPGELVPTLAETARGCQGSIVGFPAPPFSQPW
DEGWSVGPGTPPHPPRLSPGVQELLEEGAGDTPVGRGDWVVTEGMWVQPLGSLAQGPXQS
PTWLLYSHPVLRRPRLHMGISLSRSPLDPHSWTEPWVIYEGPSGYSDLASIGPTPQGAPA
FACLYESGARVSYEEISFCMFSLPEVLENVLAIPEPPSPGGKPRGYCRPS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggcatagcctcaggcaacctgttggtgaaggcccaaatctgggaccagaggcatgcc
tcctcgaggacaaagcacacgtgtggacacactgcccagcggaagaacacaagcccaggg
aatctggagggccttgggcagcagggccgggtccctgaaggagctcggagtggctccctg
ctgtttgccggccacggagacacggcgctggtcactgagacacagacccatgggcagtgc
ttcgaagacgggccccgggagccgggacgagggggcgggaacacgttatcggagcatgac
gcgcgcacgtacactgtcttccttttcttcatagcgtgcngcggccgcacctccgagacg
gcgcagataggaggaggcaccaacgcagagcagatctgctgcgtgaccagccgggacccg
gggcgcagctgtcacggcgcgcgggacctcacggcggaggcggtgggcggcgccgagcag
gactgggccaccttcgctgttggcccgggacatggcatccagctgcgctcaggccgcctg
ctggtgccggcctacacctaccgtgtggaccggcgagagtgctttggcaagatctgcagg
accagcccccactcctttgccttctacagcgatgaccatggccgcacctggcaccacgga
ggcgtcgtgcccaacctgcgctcgggcgagtgccagttggctgtggtagacggggagcag
gccagcggcatcctctactgtaatgcccggagccccctgggcagccgtgtgcaggcgctc
agtacagatgagggcacctccttcctgcccggggagctggtgcccaccctggctgagacc
gcccggggctgccagggcagcattgtgggcttcccggccccgccctttagccagccctgg
gatgagggatggtcagtgggtccaggaaccccccctcaccctccacgcctcagtcctgga
gtccaggaactcctagaggagggcgctggagacactccagtggggcgaggggactgggtg
gtgacagaggggatgtgggtacagcccctggggagcctggcccagggcccnnnncagagc
cccacatggctgctgtactcccacccggtgcttcgcaggcctcgcctccatatgggcatc
tccctgagccggtcccccctggacccccacagctggacggagccttgggtgatctatgag
ggccccagtggctactctgacctggcgtccattgggcccaccccccagggagccccggcc
ttcgcctgtctgtatgaaagtggggccagggtctcctatgaggagatctccttctgcatg
ttctccctgcccgaggtcctggagaacgtgctggccatccccgagccgcccagccctggg
ggcaaacctcgggggtactgccggccctcctga

DBGET integrated database retrieval system