KEGG   Equus caballus (horse): 100146641Help
Entry
100146641         CDS       T01058                                 

Gene name
NEU4
Definition
sialidase 4
Orthology
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
ecb  Equus caballus (horse)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100146641 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100146641 (NEU4)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100146641 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 470 aa AA seqDB search
MGIASGNLLVKAQIWDQRHASSRTKHTCGHTAQRKNTSPGNLEGLGQQGRVPEGARSGSL
LFAGHGDTALVTETQTHGQCFEDGPREPGRGGGNTLSEHDARTYTVFLFFIACXGRTSET
AQIGGGTNAEQICCVTSRDPGRSCHGARDLTAEAVGGAEQDWATFAVGPGHGIQLRSGRL
LVPAYTYRVDRRECFGKICRTSPHSFAFYSDDHGRTWHHGGVVPNLRSGECQLAVVDGEQ
ASGILYCNARSPLGSRVQALSTDEGTSFLPGELVPTLAETARGCQGSIVGFPAPPFSQPW
DEGWSVGPGTPPHPPRLSPGVQELLEEGAGDTPVGRGDWVVTEGMWVQPLGSLAQGPXQS
PTWLLYSHPVLRRPRLHMGISLSRSPLDPHSWTEPWVIYEGPSGYSDLASIGPTPQGAPA
FACLYESGARVSYEEISFCMFSLPEVLENVLAIPEPPSPGGKPRGYCRPS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggcatagcctcaggcaacctgttggtgaaggcccaaatctgggaccagaggcatgcc
tcctcgaggacaaagcacacgtgtggacacactgcccagcggaagaacacaagcccaggg
aatctggagggccttgggcagcagggccgggtccctgaaggagctcggagtggctccctg
ctgtttgccggccacggagacacggcgctggtcactgagacacagacccatgggcagtgc
ttcgaagacgggccccgggagccgggacgagggggcgggaacacgttatcggagcatgac
gcgcgcacgtacactgtcttccttttcttcatagcgtgcngcggccgcacctccgagacg
gcgcagataggaggaggcaccaacgcagagcagatctgctgcgtgaccagccgggacccg
gggcgcagctgtcacggcgcgcgggacctcacggcggaggcggtgggcggcgccgagcag
gactgggccaccttcgctgttggcccgggacatggcatccagctgcgctcaggccgcctg
ctggtgccggcctacacctaccgtgtggaccggcgagagtgctttggcaagatctgcagg
accagcccccactcctttgccttctacagcgatgaccatggccgcacctggcaccacgga
ggcgtcgtgcccaacctgcgctcgggcgagtgccagttggctgtggtagacggggagcag
gccagcggcatcctctactgtaatgcccggagccccctgggcagccgtgtgcaggcgctc
agtacagatgagggcacctccttcctgcccggggagctggtgcccaccctggctgagacc
gcccggggctgccagggcagcattgtgggcttcccggccccgccctttagccagccctgg
gatgagggatggtcagtgggtccaggaaccccccctcaccctccacgcctcagtcctgga
gtccaggaactcctagaggagggcgctggagacactccagtggggcgaggggactgggtg
gtgacagaggggatgtgggtacagcccctggggagcctggcccagggcccnnnncagagc
cccacatggctgctgtactcccacccggtgcttcgcaggcctcgcctccatatgggcatc
tccctgagccggtcccccctggacccccacagctggacggagccttgggtgatctatgag
ggccccagtggctactctgacctggcgtccattgggcccaccccccagggagccccggcc
ttcgcctgtctgtatgaaagtggggccagggtctcctatgaggagatctccttctgcatg
ttctccctgcccgaggtcctggagaacgtgctggccatccccgagccgcccagccctggg
ggcaaacctcgggggtactgccggccctcctga

DBGET integrated database retrieval system