KEGG   Equus caballus (horse): 100146723Help
Entry
100146723         CDS       T01058                                 

Definition
chymotrypsinogen B-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     100146723
Peptidases [BR:ecb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100146723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 303 aa AA seqDB search
MAFLWLLSCFALVGAAFGCGVPAIQPMLSGLSRIVNGEDAVPGSWPWQVSLQYSSGFHFC
GGSLINENWVVTAAHCSVTTSHRVVLGEFDQGSSQENIQVLKIAKVVKNPSYSSLTIRND
ITLVKLASSARLSNTVSPLCLPSANDNFPAGTLSVTTGWGKTQYDGHGSPGCSFNWTEAA
RKGQQGEGAPSSAAEGGGSPPGSPVRRTRSPLPGKGDEGPSAHHTAPGLAGQGLFERLCL
KPSPPAWCGPGDSGGPLVAQKNGAWTLVGIVSWGSSVCSTSTPGVYTRVTEFVSWIQQTL
AAN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcctttctctggctcctctcttgcttcgccctcgtgggggctgcctttggctgcggg
gtcccagccatccagcccatgctgagtggcctgtccaggatcgtcaatggggaagatgct
gtccctggctcctggccctggcaggtgtccctgcagtacagctccggcttccacttctgc
ggcggctccctcatcaacgagaactgggtggtcaccgcagcccactgcagcgtcacgacc
tcccaccgggtcgtccttggggagttcgaccagggctcaagtcaggagaacatccaggtc
ctgaagattgccaaggttgtcaagaaccccagttacagctcgctcaccatccgcaatgac
atcaccctggtgaagctggcgtcctccgcccgcctctcaaacaccgtgtcccccttgtgc
ctgcccagcgctaatgataacttccccgccgggacactgagcgtcaccacgggctggggc
aagacccagtacgacggccacggctcgcccggctgctcctttaactggacagaagcagcc
aggaaagggcagcagggggagggtgctccctcgtcggccgccgagggtggcgggtcccct
ccagggtctcccgtcaggaggacgcggagccccttgcctggaaagggagacgagggcccc
tccgcccaccacacggcgccggggctggcagggcagggcttgtttgaacgactgtgcttg
aagccgagtccccccgcctggtgtggacccggcgactctggtggccctctggtcgcccag
aagaatggagcctggaccctggtgggcatcgtgtcctggggcagttccgtctgctccacc
tccacgcctggtgtgtacacccgtgtcaccgagttcgtatcctggattcagcagaccctg
gctgccaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system