KEGG   Equus caballus (horse): 100146754Help
Entry
100146754         CDS       T01058                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
ecb  Equus caballus (horse)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100146754 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100146754 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100146754 (PFN3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100146754 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 137 aa AA seqDB search
MGDWKSYISAVLRDQRVDDVAIVGHSDNSCVWASRPGGLLAAISPQEVGVLIGPDRRTFL
KAGLSVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGM
LNKMVHGLIRGLRAQGT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggaaaagctacataagtgcggtgctgcgggaccagcgcgttgacgacgtg
gccatcgtgggccattcggacaatagctgcgtgtgggcatcgcggcccgggggcctgctg
gcggccatctccccgcaggaggtgggtgtgctgatagggccggaccggcgcaccttcctg
aaggccggcctgagcgtggcgggccgccgctgctgcgtcattcgcgatcacctgctggcc
gagggcgacggagtactggacgcacgcaccaagggcctagacgggcgcgccgtctgcgtg
ggccacactccgcgcgcgctcctcgtgctcatgggtcggcggggcgtgcacggaggcatg
ctcaacaagatggtgcacgggctgatccgcgggctgcgtgcgcagggcacctag

DBGET integrated database retrieval system