KEGG   Equus caballus (horse): 100146782Help
Entry
100146782         CDS       T01058                                 

Gene name
RAD54B
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
ecb  Equus caballus (horse)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    100146782 (RAD54B)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     100146782 (RAD54B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 910 aa AA seqDB search
MRRSAAPSQLQGNPFKKPKFIPPARSNPSLNEEITKLNPDIKLLEVATSKTFLQSQNDPR
KCSLNLLPTEESAREINHGDNYRGKYCFEACAMATLDPHHTVHSAPKEITVSKGQEEEPA
SLVKYFSVVWCKASKKKHKKWEGDAVLIVKGKSFTLKNLEGKDIGRGIGYKFRELEKIEE
GQTMMIGGKEIEVMGIISPDDFSSGRCFQLGGKSPAISNFCQAAKKCFSNPLKSVYKPSS
KENRQNSFCNCKPRHDPCAPNSLVMLRPDSRHQWMFNKNCFPLVDVVIDPHLVCHLRPHQ
KEGIRFLYECVMGFRVNDRYGAILADEMGLGKTIQCISLIWTLQCQGPYGGKPVIKKTLI
VTPGSLVNNWRKEFQKWLGSERIKIFAVGQDHKIEEFTKSPFYSVLIISYEMLLRSLDQV
KNIKFDLLICDEGHRLKNSAVKTTAALISLSCEKRVILTGTPVQNDLQEFFALIDFVNPG
ILGPLSSYRKIYEEPIILSRQPSASEEEKELGERRAAELTCLTGLFILRRTQEVINKYLP
PKIENVVFCQPAALQIELYRKLLNSRAVRFCLQGLLENSPHLICIGALKKLCNHPCLLFN
SIKEKECSSTWDKNEERSLYEGLINVFPADYNPFMFTEEESGKLQVLSKLLAVIRELCPA
EKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPVSQRQQIVDSFNSKYSSDFIFLLSS
KAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKHPVHIYRLLTTGTIEEKIYQ
RQISKQDLSGAVVDLTKTSEHTQFSVEELKNLFTLHESSHCVTHDLLDCECTGGKDHTGD
ALEKFPISRSCQLGPHPQKSHSLKPLSMAQLKQWKHFSGDHLSLTDPFLERIRENVSFFF
QNITNQTTAI
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgagacgatctgcagcaccaagccagttgcaagggaatcccttcaaaaaaccaaaattt
ataccaccggcaagaagtaatccaagtctgaatgaagagattacaaagctgaatccagat
ataaaattattggaggttgctacaagtaagacttttctgcagtcacaaaatgatcccaga
aaatgcagtttaaatcttctgcctactgaagaaagtgctagagaaattaaccacggggat
aattacaggggaaaatattgttttgaggcatgtgcaatggcaacattagacccacatcat
acagttcattcagcccctaaagaaataacagtgtctaagggacaagaagaggaacctgct
agcctagttaaatatttcagtgttgtttggtgtaaggcttcaaagaaaaaacacaagaag
tgggaaggtgatgctgttcttattgttaaaggaaagtcatttacattaaagaatttggaa
ggcaaagacattggaagaggcattggatataaattcagagagcttgaaaaaatcgaagag
ggtcaaacaatgatgattggtggaaaagaaatagaagtcatgggaataatctctccagat
gatttcagcagtgggagatgttttcagcttggaggaaaaagtcctgctatctcaaatttt
tgtcaagctgccaagaagtgtttctctaaccctttaaaaagtgtctataaaccaagctca
aaggaaaatagacagaatagtttctgtaactgcaaaccacgccatgacccatgtgctcca
aattcccttgttatgctgcgaccggacagccgtcaccagtggatgttcaataagaactgc
ttccctctcgtggacgtagtgatagatcctcaccttgtgtgtcatcttcgaccacatcag
aaggaaggaatcagattcctttatgagtgtgtgatgggattcagagtgaatgacagatat
ggagctattcttgctgatgaaatgggtttagggaaaacaatacaatgtatttcgctcatc
tggactctccagtgtcagggaccctatggaggcaagccagtaataaagaagacactaatt
gtcactcctggaagcttggtgaataattggaggaaagaatttcaaaaatggctaggaagt
gaaaggatcaagatatttgctgttggtcaggaccacaaaatagaagaattcaccaaatct
ccattttattctgttcttatcatcagttacgaaatgttacttcgttccctggaccaagtt
aagaatataaagtttgatcttctaatctgtgatgaagggcatcgtttgaagaacagtgcc
gttaagacaactgcagccctcattagcctctcttgtgagaaaagagtaattctaactggt
actccagttcagaatgatctccaagaattttttgcattaattgattttgtaaatccgggg
atattaggccctttgtcatcttatagaaaaatatatgaagaacccatcattctatcgaga
caaccttctgcttctgaggaagaaaaggaattaggagagagaagagcagctgaacttact
tgcctcactggactctttatccttagaagaacccaagaagtcataaataaatatcttcca
cctaaaatagagaatgtagtcttttgccaaccagcagcactacagattgaactttatcga
aagctgttgaattctcgggctgtcaggttctgtcttcaagggctgttggaaaatagtcct
catctaatatgtattggagctcttaaaaaactgtgcaatcacccctgccttttgttcaac
tctataaaggaaaaagaatgcagctcaacttgggataaaaatgaagaaagaagtctatat
gagggcttgataaatgtgttccctgctgattacaacccattcatgtttactgaggaagag
tcaggcaaactacaggtgctgtcaaagctcttagcggtcatccgagaactgtgtcctgct
gaaaaggtggtgttggtatccaactacacacaaaccttgaatattttacaagaagtatgc
aagcgtcatggatatgcttatacaagacttgatggacaaacaccagtctctcaaaggcag
caaattgttgatagctttaatagtaaatactcttctgattttatttttttgttaagctca
aaagctggtggtgtgggacttaaccttattggaggatctcacttaattctctatgatatt
gattggaatccagccactgatatccaggcaatgtctagagtatggagagatggtcagaaa
catcctgtacatatttacagacttctaaccacaggtacaatagaagaaaagatctatcaa
aggcagatcagtaagcaagatctttctggggcagttgtagacctaaccaagacatctgaa
catactcagttttcggtagaggaacttaagaatttattcacattacatgaaagttcacat
tgtgttactcatgacctgcttgactgtgaatgtacaggaggaaaagatcatacaggtgat
gcattggaaaaattccctatctctagaagttgtcagcttggtccacatccacagaagtct
cactccctgaaacctctctccatggcacagctgaagcaatggaagcatttttctggagat
catttaagtcttacagatccttttcttgaaagaataagagaaaatgtgtcattctttttt
cagaatataaccaatcaaactactgctatataa

DBGET integrated database retrieval system