KEGG   Equus caballus (horse): 100146854Help
Entry
100146854         CDS       T01058                                 

Gene name
TYMP
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ecb  Equus caballus (horse)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100146854 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100146854 (TYMP)
 Human Diseases
  Cancers
   05219 Bladder cancer
    100146854 (TYMP)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100146854 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
28
AA seq 398 aa AA seqDB search
MAAPATSAPSAPPAPVAPGDLSEGGSRGPPDLPPEPKQLPELIRLKRDGGRLSDVDIRGF
VRAVVDGSAHGAQIGAMLMAIRLRGMDLEETVALTRALATSGQQLEWPEAWRSQLVDKHS
TGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFTVIQSPEQMQGLL
EQVGCCIVGQSKKLVPADGILYEARDVTATVDSLPLITASILSKKVVESLSALVVDVKFG
GAAVFPSQAQARELAEVLVGVGAGLGLRVAAALTAMNNPLGRSVGHSLEVEEALLCMDGA
GPPDLRDLVTRLGGVLLWLSRQAETQDEGAARVAQTLDDGSARDRFERMLAGQGVDPGLA
RALCSGTPAQRRQLLPRAREQEELHAPGDGTVSWSRRY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccagcgacctcagcaccctcggccccacccgccccggtcgcgcctggtgac
ctctcggagggcgggagtcggggccctcctgacctcccgccggagcccaagcagctccca
gagctgatccgcctgaagcgagacggaggccgcctgagtgatgtggacatcaggggcttc
gtgcgcgccgtggtggacgggagcgcgcacggcgcgcaaatcggggccatgctcatggcc
atccgactgcgaggcatggatctggaggagaccgtggcgctgacccgggccctggccacg
tccggacagcagttggagtggccggaggcctggcgctcgcagctcgtagacaaacactcc
acaggaggagtgggtgacaaagtcagcctggtcctggcacctgccctggctgcctgtggc
tgcaaggtaccaatgatcagcggacgcggtctggggcacactgggggcacactggataaa
ctggagtctattcctggattcactgtcatccagagcccagagcagatgcaagggctcctg
gagcaagtgggctgctgtatcgtgggtcagagcaagaagctggttcctgctgatggaatc
ctttatgaagccagagatgtgacagccactgttgacagcctgccacttatcacagcctcc
atcctcagtaagaaggtggtggagagcctgtctgctctggtggtggatgtgaagttcgga
ggggctgcagtcttccctagccaggcacaggcccgggaactggcagaagtgctggttggc
gtgggagccggcctggggcttcgggtcgcggcggctctgacggccatgaacaaccccctg
ggccgcagcgtgggccacagcctggaggtggaggaggcgctgctttgcatggatggtgcc
gggccgccggacctgcgagacctggtcactaggctcggaggggtcctgctctggctcagc
agacaggcggagacccaggacgaaggcgccgcccgggtggcccagaccctggacgacggc
tcagcccgggaccggttcgagcggatgctcgcggggcagggcgtggacccgggcctggcc
cgagccctatgctctgggactcccgcgcagcgccggcagctgttgccccgcgcccgggag
caggaggagctgcacgcgcccggagacggcacggtgagctggtccaggcgctac

DBGET integrated database retrieval system