KEGG   Equus caballus (horse): 100146854Help
Entry
100146854         CDS       T01058                                 

Gene name
TYMP
Definition
(RefSeq) thymidine phosphorylase isoform X1
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00240  Pyrimidine metabolism
ecb00983  Drug metabolism - other enzymes
ecb01100  Metabolic pathways
ecb05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100146854 (TYMP)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100146854 (TYMP)
 Human Diseases
  Cancers
   05219 Bladder cancer
    100146854 (TYMP)
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100146854 (TYMP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-GeneID: 100146854
NCBI-ProteinID: XP_023487340
Ensembl: ENSECAG00000001072
Position
28
AA seq 585 aa AA seqDB search
MAAPATSAPSAPPAPVAPGDLSEGGSRGPPDLPPEPKQLPELIRLKRDGGRLSDVDIRGF
VRAVVDGSAHGAQIGAMLMAIRLRGMDLEETVALTRALATSGQQLEWPEAWRSQLVDKHS
TGGVGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFTVIQSPEQMQGLL
EQVGCCIVGQSKKLVPADGILYEARDVTATVDSLPLITASILSKKVVESLSALVVDVKFG
GAAVFPSQAQARELAEVLVGVGAGLGLRVAAALTAMNNPLGRSVGHSLEVEEALLCMDGA
GPPDLRDLVTRLGGVLLWLSRQAETQDEGAARVAQTLDDGSARDRFERMLAGQGVDPGLA
RALCSGTPAQRRQLLPRAREQEELHAPGDGTVELVQALPLARVLHELGAGRSRAGEPLRP
GVGAEVLVSVGQRLRRGERRSWPLLAPAGRLARWPPVWPPCLLVASPAGRPSGLPACWPP
RPLAAAPSDPFGPPCRDAMASRAPGRARAQRRAAPRSAGGAGALGPRALRRPLALRRARS
AAAQDHVHPHAAMKPRVPSPIHACGEINKGKPLKWGPEDRRESAT
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccagcgacctcagcaccctcggccccacccgccccggtcgcgcctggtgac
ctctcggagggcgggagtcggggccctcctgacctcccgccggagcccaagcagctccca
gagctgatccgcctgaagcgagacggaggccgcctgagtgatgtggacatcaggggcttc
gtgcgcgccgtggtggacgggagcgcgcacggcgcgcaaatcggggccatgctcatggcc
atccgactgcgaggcatggatctggaggagaccgtggcgctgacccgggccctggccacg
tccggacagcagttggagtggccggaggcctggcgctcgcagctcgtagacaaacactcc
acaggaggagtgggtgacaaagtcagcctggtcctggcacctgccctggctgcctgtggc
tgcaaggtaccaatgatcagcggacgcggtctggggcacactgggggcacactggataaa
ctggagtctattcctggattcactgtcatccagagcccagagcagatgcaagggctcctg
gagcaagtgggctgctgtatcgtgggtcagagcaagaagctggttcctgctgatggaatc
ctttatgaagccagagatgtgacagccactgttgacagcctgccacttatcacagcctcc
atcctcagtaagaaggtggtggagagcctgtctgctctggtggtggatgtgaagttcgga
ggggctgcagtcttccctagccaggcacaggcccgggaactggcagaagtgctggttggc
gtgggagccggcctggggcttcgggtcgcggcggctctgacggccatgaacaaccccctg
ggccgcagcgtgggccacagcctggaggtggaggaggcgctgctttgcatggatggtgcc
gggccgccggacctgcgagacctggtcactaggctcggaggggtcctgctctggctcagc
agacaggcggagacccaggacgaaggcgccgcccgggtggcccagaccctggacgacggc
tcagcccgggaccggttcgagcggatgctcgcggggcagggcgtggacccgggcctggcc
cgagccctatgctctgggactcccgcgcagcgccggcagctgttgccccgcgcccgggag
caggaggagctgcacgcgcccggagacggcacggtggagctggtccaggcgctaccgctg
gcgcgcgtgctgcacgaactcggggccgggcgcagccgcgccggggagccactccggccg
ggggtgggcgccgaggtgctagtcagcgtgggtcagagactgcgccgcggtgagcgccga
tcctggcccctcctcgcccccgccggtcgcctcgcccgttggccgcccgtctggccgccc
tgcttgctggtcgcctcgcccgctggccgcccgtccggcctccccgcttgctggccgcct
cgcccgctggccgccgcgccttctgacccctttgggccgccctgcagggatgccatggct
tcgcgtgcacctggacgcgcccgcgctcagcgccgcgcagcgccgcgctctgcaggaggc
gctggtgctctcggaccgcgcgcccttcgccgccccctcgcccttcgcagagctcgttct
gccgccgcccaggaccatgtccacccacacgcagcaatgaagccgagagtgccaagtcct
atccatgcctgtggggagattaataaagggaaacctttaaaatggggtccagaggacagg
agggagagtgccacatag

DBGET integrated database retrieval system