KEGG   Equus caballus (horse): 100146977Help
Entry
100146977         CDS       T01058                                 

Definition
UDP-glucuronosyltransferase 2C1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ecb  Equus caballus (horse)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100146977
   00053 Ascorbate and aldarate metabolism
    100146977
   00500 Starch and sucrose metabolism
    100146977
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100146977
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100146977
   00860 Porphyrin and chlorophyll metabolism
    100146977
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100146977
   00982 Drug metabolism - cytochrome P450
    100146977
   00983 Drug metabolism - other enzymes
    100146977
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100146977
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100146977
Glycosyltransferases [BR:ecb01003]
 Others
  Hydrophobic molecule
   100146977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 529 aa AA seqDB search
MKTAKGFCVLFMLHLCFFDSGRTGKVLVWPMDFSHWINLKVILEELHLRGHEITILVPSP
SLLMDHTKIPFNVEILQLPVTKETLLEELNTVLYVAAFELPKLSWWDMQVKLTEMSNRFS
RTAKRVCDSAITNKELLSRLQAAKFDICISDPLSFCGELLAELLDIPFVYSFRFSFGNFI
ERLCAGLPTSSSYVPGSTSGLTDNMTFVQRLRNWFLYVMSGVIYSYFLLPEWNEYYSKVL
GKPTTVCETMGKAEMWLIRTSWEFEFPYPYLPHFEFVGGLHCKPAKPLPKELEEFVQSSG
KDGVVIFTLGSMIHNLTEEKSNMIASALAQIPQKVLWRYTGKKPDTLGPNTRLYDWIPQN
DLLGHPKTRAFITHCGTNGIYEAIYHGVPMVGIPMFGDQVDNIARIKAKGAAVDVDMRTM
TSSDLLKALKAVINNPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAS
YNLTWYQYHSLDVLGFLLACVATIIFLVTKCCLFCCWKFGKTGKKKKRE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcaaaaggcttttgtgttcttttcatgctgcatctgtgtttctttgactct
gggaggactgggaaagtacttgtatggcccatggattttagtcactggatcaatttaaaa
gttattctggaagagctccatcttcgtgggcatgaaataaccattctggtaccttcacca
agccttctaatggatcacaccaagattccctttaatgtagagatccttcaacttccagta
actaaggaaactctcctggaagagctcaatactgttctctatgtagctgcttttgaactg
ccaaaactttcatggtgggacatgcaagtaaaactaacagaaatgagcaaccgtttttca
aggacagccaaaagagtatgtgacagtgctatcacaaataaggagttactcagcaggcta
caggcagctaagtttgatatctgcatttctgatcctttaagtttttgtggggagttgttg
gctgagcttctcgatattccatttgtatactcttttaggttttctttcggtaatttcatt
gaaagactgtgtgctgggcttccaacttcttcttcttatgttcctggtagcacatcaggg
ctgacagacaacatgacttttgtacagaggctgaggaattggttcttgtatgtaatgagt
ggcgtgatctattcgtattttctacttccggaatggaatgagtattatagcaaggtttta
ggaaaacctaccacagtatgtgagactatggggaaagcagaaatgtggttgattcgaact
tcctgggaatttgaatttccttacccttatctacctcactttgaatttgttggaggacta
cactgcaagcctgcaaagcccctcccgaaggagttagaagagtttgtccagagctctgga
aaagatggagttgtaatatttaccctggggtcaatgatccacaatctcacagaagaaaag
tctaacatgattgcatcagcccttgcccagattccacagaaggttctgtggagatacaca
ggaaagaaaccagatacattaggacccaatacacggctgtatgactggattccacagaat
gatcttctcggtcatcccaaaaccagagcttttatcactcactgtggaaccaacgggatc
tatgaagctatttaccatggggtccctatggtgggaattcccatgtttggtgatcaggtt
gataatattgctcgtataaaggccaaaggggcagctgttgacgtagacatgcgtacaatg
accagttctgatctgcttaaagctttgaaggcagtcattaacaacccttcctataaagag
aatgctatgaggttatcaagaattcaccacgatcagcctgtgaagcccctggatcgagca
gtcttctggattgagtttgtcatgcgccacaaaggagccaaacacctgcggccagcctcc
tacaatctcacctggtaccagtaccattctttggatgtgcttgggttcctgctagcctgt
gtggcaactattatctttctggtcacaaaatgttgcctgttctgttgctggaagtttggt
aagacaggaaagaagaaaaagagagagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system