KEGG   Equus caballus (horse): 100146977Help
Entry
100146977         CDS       T01058                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2C1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ecb  Equus caballus (horse)
Pathway
ecb00040  Pentose and glucuronate interconversions
ecb00053  Ascorbate and aldarate metabolism
ecb00140  Steroid hormone biosynthesis
ecb00830  Retinol metabolism
ecb00860  Porphyrin and chlorophyll metabolism
ecb00980  Metabolism of xenobiotics by cytochrome P450
ecb00982  Drug metabolism - cytochrome P450
ecb00983  Drug metabolism - other enzymes
ecb01100  Metabolic pathways
ecb05204  Chemical carcinogenesis
Module
ecb_M00014  Glucuronate pathway (uronate pathway)
ecb_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100146977
   00053 Ascorbate and aldarate metabolism
    100146977
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100146977
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100146977
   00860 Porphyrin and chlorophyll metabolism
    100146977
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100146977
   00982 Drug metabolism - cytochrome P450
    100146977
   00983 Drug metabolism - other enzymes
    100146977
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100146977
Enzymes [BR:ecb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100146977
Glycosyltransferases [BR:ecb01003]
 Others
  Hydrophobic molecule
   100146977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 100146977
NCBI-ProteinID: XP_001916485
Ensembl: ENSECAG00000008247
Position
3
AA seq 530 aa AA seqDB search
MMKTAKGFCVLFMLHLCFFDSGRTGKVLVWPMDFSHWINLKVILEELHLRGHEITILVPS
PSLLMDHTKIPFNVEILQLPVTKETLLEELNTVLYVAAFELPKLSWWDMQVKLTEMSNRF
SRTAKRVCDSAITNKELLSRLQAAKFDICISDPLSFCGELLAELLDIPFVYSFRFSFGNF
IERLCAGLPTSSSYVPGSTSGLTDNMTFVQRLRNWFLYVMSGVIYSYFLLPEWNEYYSKV
LGKPTTVCETMGKAEMWLIRTSWEFEFPYPYLPHFEFVGGLHCKPAKPLPKELEEFVQSS
GKDGVVIFTLGSMIHNLTEEKSNMIASALAQIPQKVLWRYTGKKPDTLGPNTRLYDWIPQ
NDLLGHPKTRAFITHCGTNGIYEAIYHGVPMVGIPMFGDQVDNIARIKAKGAAVDVDMRT
MTSSDLLKALKAVINNPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRPA
SYNLTWYQYHSLDVLGFLLACVATIIFLVTKCCLFCCWKFGKTGKKKKRE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagactgcaaaaggcttttgtgttcttttcatgctgcatctgtgtttctttgac
tctgggaggactgggaaagtacttgtatggcccatggattttagtcactggatcaattta
aaagttattctggaagagctccatcttcgtgggcatgaaataaccattctggtaccttca
ccaagccttctaatggatcacaccaagattccctttaatgtagagatccttcaacttcca
gtaactaaggaaactctcctggaagagctcaatactgttctctatgtagctgcttttgaa
ctgccaaaactttcatggtgggacatgcaagtaaaactaacagaaatgagcaaccgtttt
tcaaggacagccaaaagagtatgtgacagtgctatcacaaataaggagttactcagcagg
ctacaggcagctaagtttgatatctgcatttctgatcctttaagtttttgtggggagttg
ttggctgagcttctcgatattccatttgtatactcttttaggttttctttcggtaatttc
attgaaagactgtgtgctgggcttccaacttcttcttcttatgttcctggtagcacatca
gggctgacagacaacatgacttttgtacagaggctgaggaattggttcttgtatgtaatg
agtggcgtgatctattcgtattttctacttccggaatggaatgagtattatagcaaggtt
ttaggaaaacctaccacagtatgtgagactatggggaaagctgaaatgtggttgattcga
acttcctgggaatttgaatttccttacccttatctacctcactttgaatttgttggagga
ctacactgcaagcctgcaaagcccctcccgaaggagttagaagagtttgtccagagctct
ggaaaagatggagttgtaatatttaccctggggtcaatgatccacaatctcacagaagaa
aagtctaacatgattgcatcagcccttgcccagattccacagaaggttctgtggagatac
acaggaaagaaaccagatacattaggacccaatacacggctgtatgactggattccacag
aatgatcttctcggtcatcccaaaaccagagcttttatcactcactgtggaaccaacggg
atctatgaagctatttaccatggggtccctatggtgggaattcccatgtttggtgatcag
gttgataatattgctcgtataaaggccaaaggggcagctgttgacgtagacatgcgtaca
atgaccagttctgatctgcttaaagctttgaaggcagtcattaacaacccttcctataaa
gagaatgctatgaggttatcaagaattcaccacgatcagcctgtgaagcccctggatcga
gcagtcttctggattgagtttgtcatgcgccacaaaggagccaaacacctgcggccagcc
tcctacaatctcacctggtaccagtaccattctttggatgtgcttgggttcctgctagcc
tgtgtggcaactattatctttctggtcacaaaatgttgcctgttctgttgctggaagttt
ggtaagacaggaaagaagaaaaagagagagtag

DBGET integrated database retrieval system