KEGG   Equus caballus (horse): 100147361Help
Entry
100147361         CDS       T01058                                 

Gene name
USP25
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 25 isoform X1
  KO
K11849  ubiquitin carboxyl-terminal hydrolase 25 [EC:3.4.19.12]
Organism
ecb  Equus caballus (horse)
Pathway
ecb04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100147361 (USP25)
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100147361 (USP25)
Peptidases [BR:ecb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100147361 (USP25)
Ubiquitin system [BR:ecb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100147361 (USP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 UIM UBA_4
Motif
Other DBs
NCBI-GeneID: 100147361
NCBI-ProteinID: XP_023485657
Position
26
AA seq 1136 aa AA seqDB search
MTVEQNVLQQSAAQKASTGGLGTYLSQHQQTFLNQLREITGINDAQILQQALKDSNGNLE
LAVAFLTAKNAKTPQQEETTYYQTALPGNDRYISVGSQADANVIDLTGDDEDDLQRAVAL
SLAESNRAFRETGMTDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAP
VGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSHAQDLPRNQKEHRNLPFMRELRYL
FALLVGTKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDE
EKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIES
LHSENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMLRN
REITRIKREEIKRLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSP
IDDIDASSPPSGSVSSQTLPSTTEQQGTPSSELPSTSPASVAAISSRSVIHKPFTQSRIP
PDLPMHPAPRHITEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQ
VPYRLHAVLVHEGQANAGHYWAYIFDHHENRWMKYNDIAVTKSSWEELVRDSFGGYRNAS
AYCLMYINDKAQFLIQEEFNKETGQALVGIETLPPDLRDFVEEDNQRFEKELEEWDTQLA
QKALQEKLLASQKLRESESSITAAQAGEPEYLEQPSRSDFSKHLKEETVRLITKASHEHE
DKSPETVLQSKPENTTSQPPSNQQVVEVAIPHVGKFMIEAKEGGYDDEIMMTPNMQGIIM
AIGKSRNVYDRCGPEAGFFKAIKLEYSRLVKLSQEDTPPETDYRLHHVVVYFIQNEAPKK
IIEKTLLEQFGDRNLSFDERCHNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTM
YLIIGLEYFQGERYIDSLLFLIYAYQNNKELLSKGQYRGHDEELLSHYRRECLLKLNEQA
AELFESGEDREVNNGLIIMNELIVPVLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMES
NLQEKLTDFLPKLLDCSTEIKGFHEPPKLPSYSTHELCERFARIMLSLSRTPADGR
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggagcagaacgtgctgcagcagagcgcggcgcagaaggcatccactgggggt
cttggaacgtatctctcacagcaccagcagacatttttgaatcagctgagagaaattact
gggatcaacgatgcccagatactacagcaagctttgaaggatagcaatggaaacttggag
ttggcagtggctttcctcactgcgaagaatgccaagacccctcagcaggaggagacaact
tactaccaaaccgcgcttcctggcaatgatagatacatcagtgtgggaagccaagcagat
gcgaatgtgattgatctcactggagatgatgaagatgatcttcagagagcagttgccttg
agtttggcggaatcaaacagggcgttcagggagactggaatgactgatgaggagcaagcc
attagcagagttcttgaagccagcatagcagaaaataaagcctgtttgaagaggacacct
acggaagtttggagggattctcgaaacccttacgatagaaaaaggcaggacaaagctcct
gttggactaaagaatgtgggcaatacttgctggtttagtgctgttattcagtcattattc
aatcttttggaatttagaagattagtcctgaattataagcctccatcacatgctcaagat
ttaccccgaaaccaaaaggagcatcggaatttgccttttatgcgggagctgcggtatcta
tttgcacttcttgttggtactaaaaggaaatatgttgatccatcaagagcagttgaaatt
cttaaggatgctttcaagtcaaatgactcccagcagcaagacgtgagtgagtttacacac
aaattattagattggttagaagatgccttccaaatgaaagctgaagaggagacggatgaa
gagaagccaaagaacccgatggtagaattgttctatggaagattcctagctgtgggagta
cttgaaggtaaaaaatttgaaaatactgaaatgtttggtcagtacccacttcaggtcaat
ggattcaaagatctacacgagtgcctagaagctgctatgattgaaggagaaattgagtct
ttacattcagagaattcaggaaaatcaggccaagagcattggtttactgaactaccacct
gtgttaacatttgaattgtcaagatttgaatttaatcaggcattgggaagaccagaaaaa
attcacaacaaattagaatttcctcaggttttatatctggacagatacatgctcagaaac
agagaaataacaagaattaagagggaagagatcaagagactaaaagattacctcacagta
ttacaacagagactagaaagatatttaagctatggctcgggtcccaaacgattccccctg
gtagatgttctgcagtacgccttggaatttgcctcaagtaaacctgtttgcacttctcct
atcgatgatattgatgctagttccccacctagtggttccgtgtcatcacagacattacca
agtacaacagagcaacagggaactccttcttcagaactgccaagcacgtcacctgcgtca
gtagctgccatttcatcgagatcagtaatacataaaccattcacacagtctcggatacct
ccagatttgcccatgcatccagcaccaaggcacataacagaagaagaactttctgtgcta
gaaagctgtttacatcgctggaggacagaaatagaaaatgacaccagagatttgcaggaa
agcatatccagaatccatcgaacaattgaactaatgtactctgacaaatctatgatccaa
gttccttatcgcttacatgctgttttagttcatgaaggccaagctaatgccgggcactac
tgggcttacatttttgatcatcatgaaaacaggtggatgaagtacaatgatattgctgtg
acaaaatcatcatgggaagagctagtgagggactcttttggtggttatagaaatgccagt
gcatattgtttaatgtacataaatgataaagcacaattcttaatacaagaggagtttaat
aaagaaactgggcaggcccttgttggaatagaaacattaccaccggatttaagagatttt
gttgaggaagacaaccagcgatttgaaaaagaactagaagaatgggatacacaacttgcc
cagaaagctttgcaagaaaaactcttagcatctcagaagttgagggagtcagaatcttct
ataacagcagcacaagcaggagagccagaatatctagagcagccatcaagaagtgatttc
tcaaagcacttgaaagaagaaactgttcgattaattaccaaggcatcacacgagcatgaa
gataaaagtcctgaaacagttttgcagtcgaaacctgaaaataccacaagccaaccacct
tctaaccagcaagttgtagaggtggcgatccctcatgtagggaaatttatgattgaggcg
aaggaggggggttatgatgacgagatcatgatgacaccgaacatgcaaggtattatcatg
gcgataggtaaatccaggaatgtatatgacaggtgtggccctgaagcagggttctttaag
gcaattaagttggagtattcaagattggttaaattgagccaagaagacaccccaccagaa
acagattatcgtttacatcatgtagtggtctattttatccagaacgaggcaccaaagaaa
atcattgagaaaactttgctagaacaatttggagatagaaatttaagttttgatgaaagg
tgtcacaacataatgaaagttgctcaagccaaacttgaaatgatcaaacctgaagaagta
aacttggaggaatatgaggagtggcatcaggattacaggaagttcagggagacgaccatg
tatctcataattgggctggaatattttcaaggagaaaggtatatagattccttgctgttc
cttatctatgcttatcagaataacaaagaactcttgtccaaaggccaatacagaggacat
gatgaagaattattatcacattatagaagagaatgtttactaaaattaaatgagcaagct
gcagaactgtttgaatctggagaggatcgagaggtgaataatggtctgattatcatgaat
gagcttattgtcccagtgttgcccttgttattggtggatgaaatggaagagaaagatata
ctcgctgtggaagatatgcgaaatcgatggtgttcctatcttggacaggaaatggaatca
aacctccaagagaagctgacagattttctgcccaaactgcttgattgttctacggagatt
aaaggtttccatgagcctccgaagttaccttcctattccacgcatgaactctgtgagcga
tttgcccgaatcatgttgtccctcagtcgaactcctgctgatggaagataa

DBGET integrated database retrieval system