KEGG   Equus caballus (horse): 100147514Help
Entry
100147514         CDS       T01058                                 

Gene name
PDK2
Definition
pyruvate dehydrogenase kinase, isozyme 2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
ecb  Equus caballus (horse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 407 aa AA seqDB search
MHWFRALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFAEALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNRNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINATNSKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLTLPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQLGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcactggttccgcgcgctgctgaagaatgcgtccctggcaggggcgcccaagtacatc
gagcacttcagcaagttctccccgtccccgctgtccatgaagcagtttctggacttcggg
tccagcaatgcctgtgagaaaacctcattcaccttcctcaggcaggagctgcctgtgcgc
ctggccaacatcatgaaggagatcaacctgcttcccgaccgagtgctcagcaccccctcg
gtgcagctggtacagagctggtatgtccagagtctcctggacatcatggagttcctggac
aaggaccccgaggaccatcgtaccctgagccagttcgctgaagccctagtcaccatccgg
aaccgccacaatgacgtggtgcccaccatggcgcagggggtgctagagtacaaggacacc
tacggcgatgaccctgtctccaaccgcaacatccagtacttcctggaccgcttctacctc
agccgcatctccatccgcatgctcatcaaccagcacaccctgatctttgacggcagcacc
aacccagcccaccccaaacacatcggcagcattgaccccaactgcaacgtctccgaggtg
gtgaaagatgcctatgacatggccaagctcctgtgtgacaagtattacatggcctcacct
gacctggagatccaggagatcaatgcaaccaactccaaacagccaattcacatggtctat
gtcccctcccacctctaccacatgctttttgaactcttcaagaatgccatgcgagcaact
gtggaaagccacgaatccagcctcactctcccacctatcaaggtcatggtggctttgggc
gaggaagatctgtccatcaaaatgagtgaccgaggcgggggtgtccccttgaggaagatt
gagcgactcttcagctacatgtattccacagcacccaccccccagctcggcactggggga
accccactggctggcttcgggtacgggctccccatttcccgtctctatgccaagtacttc
cagggggacctgcagctcttctccatggagggctttgggacagacgctgtcatctatctc
aaggccctgtccacggactcggtggagcgcctgcctgtctacaacaagtcagcctggcgc
cactaccagaccatccaggaggctggcgactggtgtgtgcccagcacggagcccaagaac
acgtccacgtaccgtgtcagctag

DBGET integrated database retrieval system