KEGG   Equus caballus (horse): 100147675Help
Entry
100147675         CDS       T01058                                 

Definition
cytochrome P450 2S1-like
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:ecb00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:ecb00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 478 aa AA seqDB search
MLEELGSKTTHTYAHVNAHHDYDEEGGGVVTARHRVWPPEAAKVSGFQVAPVCPRPTWSP
RRCLRPQNLGDLGDIRSRARPRHQVAAVLSKQYGPVFTVYLGPWRRVVVLVGHEAVREAL
GDQAEEFSGRGMLATLDQTFDGHGVFFSSGERWRQLRRFTMLTLRDLGMGKREGEELIQA
ETQCLVEALQKTEGRAFDPSLLLAQATSNIVCSLTFGLRFPYEDKEFQALVQAAGSTLLA
ISSPWGQTYEMFSRLLQPLPGPHKQLLRHLSTLATFAAQQVQRHRGNLDSSGPAVDVVDA
FLLKMAQEEQDPNTEFTDENMLMTVTYLLFAGTMTVSTTVRYTLLLLLKYPEVQAPSPSQ
RRPPTARVPNKGTEVFPLLGSVLHDPEIFKQPEEFNPGRFLDADGRFKKQEAFLPYSLGK
RVCLGEGLARAEIFLLATAILQAFSLESASPLGALNLQPAVSGVFNIPPAFQLRVRPH
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggaacttggctcaaagacaacacacacttacgcgcacgtgaacgcacaccac
gattacgatgaggagggaggcggggtagtcaccgccaggcacagggtgtggcctcccgag
gcggccaaagtctctggcttccaggttgctcctgtttgcccacgccctacctggagccca
aggcgctgtctccgccctcagaacctgggtgacctgggagacatccgttcgagagcgcgg
cctcgacaccaggtggcggcggtgctgagtaagcagtatggaccagtgttcaccgtgtac
ctgggaccctggcggcgcgtggtggtcctggttgggcacgaggctgtgcgggaggccctg
ggagatcaagccgaggagttcagtgggcgggggatgttggcgacactggaccagaccttt
gatggccatggggtcttcttctccagtggggagcggtggaggcagctgaggagattcacc
atgctcactctgcgggacctgggcatggggaagcgagaaggcgaggagctgatccaggca
gagacccagtgtctagtggaggcgctccagaagacagaaggacgggcatttgacccctcc
ctgctgctggcgcaggccacctccaacattgtctgctccctcaccttcggcctccgtttc
ccctacgaggataaggagttccaggccttggtccaggcagctggcagcaccctgctggca
atcagctccccatggggccaaacctacgagatgttctcccggctcctgcagcccctgcca
ggcccccacaaacagctcctcagacacttgagcaccctggctaccttcgctgcccagcag
gtgcagcggcaccgggggaacctggactcctcaggccccgcagtcgatgttgtggatgcc
ttcctgctgaagatggcacaggaggaacaggacccgaacacggaattcactgacgagaac
atgctgatgacggtcacttatctgctgttcgccgggacgatgacagtgagcacaacagtc
cgctacaccctcctgctcctgctgaaataccctgaggtccaagccccgtcaccttcccag
cgcagacccccgacagccagagtccctaacaaaggcactgaggtcttccccctccttggc
tctgtcctccatgaccctgagatcttcaagcagccagaggagttcaacccaggccggttc
ctagatgcggacggaaggttcaagaagcaagaggccttcctgccctactccttaggtaag
cgtgtctgccttggggagggcctggcacgagcagagatcttcctcctggccaccgccatc
ctgcaggccttctccctggagagcgcaagcccgctgggtgccctgaaccttcagccagct
gtcagtggtgttttcaacattcccccggccttccagctgcgagtccggccccactga

DBGET integrated database retrieval system