KEGG   Equus caballus (horse): 100147675Help
Entry
100147675         CDS       T01058                                 

Definition
(RefSeq) cytochrome P450 2S1
  KO
K07420  
cytochrome P450 family 2 subfamily S polypeptide 1 [EC:1.14.14.1]
Organism
ecb  Equus caballus (horse)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100147675
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100147675
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100147675
Cytochrome P450 [BR:ecb00199]
 Cytochrome P450, animal type
  CYP2 family
   100147675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
10
AA seq 409 aa AA seqDB search
MVREQVAHSVRGTVIETPRLEERQPAHSTCPLLPPFPQLSKQYGPVFTVYLGPWRRVVVL
VGHEAVREALGDQAEEFSGRGMLATLDQTFDGHGVFFSSGERWRQLRRFTMLTLRDLGMG
KREGEELIQAETQCLVEALQKTEGRAFDPSLLLAQATSNIVCSLTFGLRFPYEDKEFQAL
VQAAGSTLLAISSPWGQTYEMFSRLLQPLPGPHKQLLRHLSTLATFAAQQVQRHRGNLDS
SGPAVDVVDAFLLKMAQEEQDPNTEFTDENMLMTVTYLLFAGTMTVSTTVRYTLLLLLKY
PEGTEVFPLLGSVLHDPEIFKQPEEFNPGRFLDADGRFKKQEAFLPYSLGKRVCLGEGLA
RAEIFLLATAILQAFSLESASPLGALNLQPAVSGVFNIPPAFQLRVRPH
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggtgagggagcaggtggctcattcagtgagagggaccgtgatagagacacctagactg
gaagagcggcagcctgcccacagcacctgcccccttctccctccctttccccagctgagt
aagcagtatggaccagtgttcaccgtgtacctgggaccctggcggcgcgtggtggtcctg
gttgggcacgaggctgtgcgggaggccctgggagatcaagccgaggagttcagtgggcgg
gggatgttggcgacactggaccagacctttgatggccatggggtcttcttctccagtggg
gagcggtggaggcagctgaggagattcaccatgctcactctgcgggacctgggcatgggg
aagcgagaaggcgaggagctgatccaggcagagacccagtgtctagtggaggcgctccag
aagacagaaggacgggcatttgacccctccctgctgctggcgcaggccacctccaacatt
gtctgctccctcaccttcggcctccgtttcccctacgaggataaggagttccaggccttg
gtccaggcagctggcagcaccctgctggcaatcagctccccatggggccaaacctacgag
atgttctcccggctcctgcagcccctgccaggcccccacaaacagctcctcagacacttg
agcaccctggctaccttcgctgcccagcaggtgcagcggcaccgggggaacctggactcc
tcaggccccgcagtcgatgttgtggatgccttcctgctgaagatggcacaggaggaacag
gacccgaacacggaattcactgacgagaacatgctgatgacggtcacttatctgctgttc
gccgggacgatgacagtgagcacaacagtccgctacaccctcctgctcctgctgaaatac
cctgagggcactgaggtcttccccctccttggctctgtcctccatgaccctgagatcttc
aagcagccagaggagttcaacccaggccggttcctagatgcggacggaaggttcaagaag
caagaggccttcctgccctactccttaggtaagcgtgtctgccttggggagggcctggca
cgagcagagatcttcctcctggccaccgccatcctgcaggccttctccctggagagcgca
agcccgctgggtgccctgaaccttcagccagctgtcagtggtgttttcaacattcccccg
gccttccagctgcgagtccggccccactga

DBGET integrated database retrieval system