KEGG   Equus caballus (horse): 100147687Help
Entry
100147687         CDS       T01058                                 

Definition
histone H2B type F-M-like
Orthology
K11252  
histone H2B
Organism
ecb  Equus caballus (horse)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:ecb05203]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:ecb05322]
Human Diseases; Substance dependence; Alcoholism [PATH:ecb05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 188 aa AA seqDB search
MAAVGSLPVTADRPRYKWAASPQQSPSSFLQKTASGMAEPGSEASSEESLGTTEPTEGAP
KSPKQKQPRCRRRRRRHCLDSFATYFPRVLRQVHEGLSLSQEAVSVLDSFAKDIFERIAD
EATCLVRSTKRSTISYGEIQTAVRLLLPGDLGKHAVAEGTKALIRSSLCVVWQQIKCRSR
YENPSDIC
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggtagggagcttgccggtgactgcagataggccgcgctataaatgggccgcc
agccctcagcagtcgccatcgtccttccttcaaaagaccgcctctggcatggctgagccc
ggctctgaggcttcctctgaggaaagcctgggcaccacggagcccacggaaggcgccccg
aagagcccgaagcagaagcagccaaggtgccgccgccgccgccgccgccactgcctcgac
agtttcgccacctatttccccagggttctgaggcaggttcacgagggcctgagcctgtct
caggaggccgtgagcgtcctggattcgttcgcgaaggacatcttcgagcgcatcgccgac
gaggccacgtgcctggtccgctccaccaagcgctccaccatctcgtacggagagatccag
accgccgtgcgcctgctgctgccgggggaccttggcaagcacgccgtggccgagggcacc
aaggccctcatcagaagttcattatgtgtggtatggcaacagataaagtgcagaagcaga
tatgagaatccctctgacatctgttag

DBGET integrated database retrieval system