KEGG   Equus caballus (horse): 100630364Help
Entry
100630364         CDS       T01058                                 

Gene name
PFN2
Definition
profilin 2
Orthology
K05759  
profilin
Organism
ecb  Equus caballus (horse)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100630364 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100630364 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100630364 (PFN2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100630364 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 177 aa AA seqDB search
MTLQFREARLHTSKLRRAVGRHRFCFPVCWLPQFSFPPPVSLHFLSASPSPRCAAAGSGL
SAFGGRGREVGESEEGDLNRAPVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGD
CTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgactctgcagtttcgagaagcgcgactacatacaagcaagcttcgccgagccgttggc
aggcaccgtttctgctttccggtttgctggctgcctcagttttcttttcccccgcccgtc
tccctccattttctctcggcctctccgtcgccccgctgcgctgctgcgggcagcggcctg
tctgcgtttggcgggaggggaagggaagttggagagagcgaggagggagatctgaatcgg
gccccagtagaaatagatatgattgtaggaaaagaccgggaaggtttctttaccaacggt
ttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtcgatggtgac
tgcacgatggacatccggacgaagagtcaaggtggggagccaacatacaacgttgccgtc
ggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccatggaggcgga
ttgaataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system