KEGG   Equus caballus (horse): 100630364Help
Entry
100630364         CDS       T01058                                 

Gene name
PFN2
Definition
(RefSeq) profilin-2 isoform X1
  KO
K05759  profilin
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04810  Regulation of actin cytoskeleton
ecb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100630364 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100630364 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100630364 (PFN2)
Membrane trafficking [BR:ecb04131]
 Others
  Actin-binding proteins
   Others
    100630364 (PFN2)
Cytoskeleton proteins [BR:ecb04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100630364 (PFN2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Proteins found in most exosomes
   100630364 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 100630364
NCBI-ProteinID: XP_023476867
Position
16
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtgtgggccgccacggccgggggcgtcttt
cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc
gatggtgactgcacgatggacatccggacgaagagtcaaggtggggagccaacatacaac
gttgccgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system