KEGG   Equus caballus (horse): 100630479Help
Entry
100630479         CDS       T01058                                 

Gene name
GTF2H4
Definition
general transcription factor IIH, polypeptide 4, 52kDa
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ecb  Equus caballus (horse)
Pathway
Basal transcription factors
Nucleotide excision repair
Viral carcinogenesis
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100630479 (GTF2H4)
  Replication and repair
   03420 Nucleotide excision repair
    100630479 (GTF2H4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100630479 (GTF2H4)
Transcription machinery [BR:ecb03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100630479 (GTF2H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 463 aa AA seqDB search
MESTPSRGGLNRVHLQCRNLQEFLGSLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRM
LFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPVFRQNLR
IALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLL
SQAGLMKSTEPGEPPCITSAGFQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQ
LSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGG
TAHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRESVQQAIASGI
TAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFE
LLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaccccctcaaggggtggactgaaccgagtacacctacaatgcaggaatctg
caggaattcctagggagcctgagccctggggttttggaccgattatatgggcaccctgcc
acctgtctggctgtcttcagggagctcccatctttggctaagaactgggtgatgcggatg
ctctttctggagcagcctttgccacaagctgctgtagctctgtgggtgaagaaggaattc
agcaaagctcaggaggaaagtacagggcttttgagcgggctccgtatctggcacacccag
ctgctccctggtggtctccagggcctcatcctcaaccccgtcttccgccagaacctccgc
attgcccttctgggtgggggcaaggcctggtctgatgacacgagtcagctgggaccagac
aagcatgcccgggatgttccctcacttgacaagtatgccgaggagcgatgggaggtggtc
ctgcatttcatggtgggctcccctagtgcagccgtcagccaggacctggctcagctcctc
agccaggctgggctcatgaagagtactgaacctggagagccaccctgcattacttctgcc
ggcttccagttcctgttgctggacacccctgcccagctctggtactttatgttgcagtat
ctgcagacagcccagagtcggggcatggacctagtggagattctctccttcctcttccag
ctcagcttctctactctgggcaaggattactctgtagaaggtatgagtgattctctgttg
aacttcctgcaacatctacgtgagtttgggcttgttttccagaggaagaggaaatctcgg
cgttactaccccacgcgcctggccatcaatctctcatcaggtgtttctggggctgggggc
actgcacatcagcctggcttcattgtcgtggaaaccaattaccgactgtatgcctacacg
gagtcggagctgcagatcgccctcattgccctcttctccgagatgctctatcgctttccc
aacatggtggtggcacaggtgaccagagagagcgtgcagcaggccatcgccagtggcatc
acagcccagcagatcatccatttcctaaggacaagggcccacccagtgatgcttaaacag
acacctgtgttgccccccaccatcactgaccagatccggctgtgggagctggaaagggac
agactccggttcactgagggcgtcttgtataaccagttcctgtcgcaagtggactttgag
ctgctgctggcgcacgcgcgggagctgggcgtgctggtgttcgagaattcggccaagcgg
ctcatggtggtgaccccggccgggcacagcgacgtcaagcgcttctggaagcggcagaag
cacagctcctga

DBGET integrated database retrieval system