KEGG   Equus caballus (horse): 102148204Help
Entry
102148204         CDS       T01058                                 

Gene name
RNASE2
Definition
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102148204 (RNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 141 aa AA seqDB search
MVPTQRDSWLCLLLLLGILGMFETQHINMTHHPCDNAMQVVNRYTKRCKNINTFLDATFA
FVANICNTTNVTCPTTGYMNCHNSSVQDVTDCDLTSVPRPYRNCRCGQTRARKYFIVACN
NSQPGDNATYSVVPVHLDWIF
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggttccaacacagcgggattcttggctttgtctccttctgctgctggggatcctggga
atgtttgaaactcagcacataaatatgacccaccatccctgcgataatgcaatgcaggtg
gttaaccgttatacgaagaggtgcaaaaatataaacacttttctcgacgcaacgtttgct
tttgtagctaacatttgtaacaccacaaatgtaacctgccctacgactggctacatgaat
tgtcataatagctcagttcaggacgtaacagactgcgacctcacctcagtaccacggcca
tataggaactgcagatgtggacagaccagggcacggaagtacttcattgttgcctgtaac
aacagtcaaccaggggacaatgccacctattcagtggttccagttcacttggattggatc
ttctaa

DBGET integrated database retrieval system