KEGG   Equus caballus (horse): 102148204Help
Entry
102148204         CDS       T01058                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: non-secretory ribonuclease
  KO
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
ecb  Equus caballus (horse)
Brite
Enzymes [BR:ecb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102148204
Messenger RNA biogenesis [BR:ecb03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     102148204
Membrane trafficking [BR:ecb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    102148204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 157 aa AA seqDB search
MVPTQRDSWLCLLLLLGILGMVTSFHDPPAGLTRAQXFETQHINMTHHPCDNAMQVVNRY
TKRCKNINTFLDATFAFVANICNTTNVTCTTTGYMNCHNSSVQDVTDCNLTSVPRPYRNC
RCGQTRARKYFIVACNNSQPGDNAAYSVVPVHLDWIF
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggttccaacacagcgggattcttggctttgtctccttctgctgctggggatcctggga
atggtgacctcattccatgatccaccggctggtttaaccagggctcagtagtttgaaact
cagcacataaatatgacccaccatccctgcgataatgcaatgcaggtggttaaccgttat
acgaagaggtgcaaaaatataaacacttttctcgacgcaacgtttgcttttgtagctaac
atttgtaacaccacaaatgtaacctgcactacgactggctacatgaattgtcataatagc
tcagttcaggacgtaacagactgcaacctcacctcagtaccacggccatataggaactgc
agatgtggacagaccagggcacggaagtacttcattgttgcctgtaacaacagtcaacca
ggggacaatgccgcctattcagtggttccagttcacttggattggatcttctaa

DBGET integrated database retrieval system