KEGG   Equus caballus (horse): 791247Help
Entry
791247            CDS       T01058                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
ecb  Equus caballus (horse)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:ecb00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    791247 (DBH)
Enzymes [BR:ecb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     791247 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
25
AA seq 610 aa AA seqDB search
MKVPSPSVREAASMYGTAVAIFLVILVAALQGSEPPESPFPYRIPLDPEGTLELSWNVSY
VQETIHFQLLVRELKAGVLFGMSDRGELENADLVVLWTDGDSAYFGDAWSDQKGWIHLDA
QQDYQLLRAQRTPEGLSLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFWSLEAINTSA
LHTGLQRVQLLKPNVSVPALPADMRTMEVRAPDVLVPGQETTYWCYITELPDGFPRHHIV
MYEPIVTEGNEALVHHMEVFQCAAEFESFPQFNGPCDSKMKPSRLNYCRNVLAAWALGAK
AFYYPEEAGLAFGGAGSSRFLRLEVHYHNPLKIEGRRDSSGIRLYYTATLRRFDAGIMEL
GLVYTPVMAIPPQETAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVVTVLARD
GREREVVNRDDHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTEDRKLATVGGFGILEEM
CVNYVHYYPQTQLELCKSAVDPGFLQKYFHFVNRFNGEEVCTCPQASVPEQFATVPWNSF
NRQVLSALYGFAPISMHCNRSSAVRFQGDWNLQPLPEIISKLEEPTPRCPASRGRSPAGP
TVVDIGGGKG
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtccccagccccagcgtgcgcgaggcagcttccatgtacggcacagcggtggcc
atcttcctggtcatcctggtggccgcgctgcagggctcggaaccccccgagagccccttt
ccttaccgcatcccgctggaccccgaggggaccctggagctctcctggaatgtcagctac
gtgcaggagaccatccacttccagctcctggtgcgggagctcaaggctggggtcctgttt
gggatgtcggaccgtggtgagttggagaacgctgacctggtcgtgctctggaccgatggg
gacagtgcctattttggggacgcctggagtgaccagaaggggtggatccacctggatgcc
cagcaggattaccagctgctgcgggcacagaggaccccagaaggcctgtccctcctcttc
aagaggccctttggcacctgtgaccccaaggattacctcatcgaggacggcaccgtccac
ttggtgtacgggatcctggaggagccgttctggtcgctggaggccatcaacacctcggcc
ctgcacacggggctgcagagggtgcagctgctgaagcccaacgtctccgtccctgccctg
cccgcggacatgcgcaccatggaggtccgtgccccagacgtcctggtccccggccaggag
accacctattggtgctacattactgagcttcccgacggcttcccccggcaccatatcgtc
atgtatgagcccattgtcaccgagggcaacgaggccctggtgcaccacatggaggtcttc
cagtgcgccgccgagttcgagagcttcccccagttcaacggaccctgcgactccaagatg
aagcccagccgcctcaactactgccgcaacgtgctggccgcctgggccctgggcgccaag
gccttttactacccagaggaagctggccttgctttcgggggtgccgggtcctccagattc
ctccgcctggaagttcactaccacaacccactgaagatagaaggccgccgcgactcctcg
ggcatccgcctgtactacacagccacgctgcgtcgctttgacgcaggcatcatggagctg
ggcctggtgtacacgcccgtgatggccatccccccgcaggagacggccttcgtcctcaca
ggctactgcaccgacaagtgcacccagctggccctgcctccctcggggatccacatcttc
gcctctcagctccacacgcacctgacggggaggaaggtggtcaccgtgctggcccgggac
ggccgagagagggaagttgtgaacagggacgaccactacagccctcacttccaggagatc
cgcatgttgaagaaggtcgtgtctgtccacccgggggatgtgctcatcacttcctgcacg
tacaacacggaagacaggaagctggccaccgtgggcggcttcggcatcctggaggagatg
tgcgtcaactacgtgcactactacccacagacacagcttgagctctgcaagagcgctgtg
gaccctggcttcctgcagaagtatttccacttcgtgaacaggttcaatggcgaggaagtc
tgcacctgccctcaggcctctgtccctgagcagtttgccactgttccctggaactccttc
aaccggcaggtgctcagcgccctgtacggcttcgcacctatctccatgcactgcaacagg
tcctcggccgtgcgtttccagggtgattggaatctgcagcccctgcccgagatcatctcc
aagctggaagagcccacccctcggtgcccagccagccggggtcggagtcccgccggcccc
accgtggtcgacattggtggaggcaaaggttga

DBGET integrated database retrieval system