KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0005Help
Entry
c0005             CDS       T00106                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00260  Glycine, serine and threonine metabolism
ecc00750  Vitamin B6 metabolism
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01230  Biosynthesis of amino acids
Module
ecc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    c0005 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    c0005 (thrC)
Enzymes [BR:ecc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     c0005 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AAN78505
UniProt: A0A0H2V5R3
Structure
PDB: 

Jmol
Position
4445..5731
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKNQGLFFPHDLPEFSLTEIDEMLKLDFVTRSAKILS
AFIGDEIPQEILEERVRAAFAFPAPVANVESDVGCLELFHGPTLAFKDFGGRFMAQILTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKVALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGQWSPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWQLKELGYAAVDDETTQQTMRELKELGYTSEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVEAILGETLDLPKELAERADLPLLSHNLPADFAAL
RKLMMNHQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatttgaaagatcacaatgagcaggtcagctttgcgcaagccgtaacc
caggggttgggcaaaaatcaggggctgtttttcccgcacgacctgccggaattcagcctg
actgaaattgatgagatgctgaagctggattttgtcacccgcagtgcgaagatcctctcg
gcgtttattggtgatgaaatcccgcaggaaatcctggaagagcgcgtacgcgcggcgttt
gccttcccggctccggtcgccaatgttgaaagcgatgtcggttgtctggaattgttccac
gggccaacgctggcatttaaagatttcggcggtcgctttatggcacaaatactgacccat
attgcgggcgataagccagtgaccattctgaccgcgacatccggtgatactggagcggca
gtggctcatgctttctacggtttaccgaatgtgaaagtggttatcctctatccacgaggc
aaaatcagtccactgcaagaaaaactgttctgtacattgggcggcaatatcgaaactgtt
gccatcgacggcgatttcgatgcctgtcaggcgctggtgaagcaggcgtttgatgatgaa
gaactgaaagtggcgctggggctaaactctgctaactccattaacatcagccgtttgctg
gcgcagatttgctactactttgaagctgttgcgcagctgccgcaggaagcgcgcaaccag
ctggttgtctcggtgccaagcggaaacttcggcgatttgacggcgggtctgctggcgaag
tcactcggtctgccggtgaaacgttttattgctgcgaccaacgtgaacgataccgtgcca
cgtttcctgcacgacggtcagtggtcacccaaagcgactcaggcgacgttatccaatgcg
atggatgttagccagccaaacaactggccgcgtgtggaagagttgttccgccgcaaaatc
tggcaactgaaagagctggggtatgcagccgtggatgatgaaaccacgcaacagacaatg
cgtgagttaaaagaactgggctatacctcggagccgcacgctgccgtagcttatcgtgcg
ctgcgtgaccagttgaatccaggcgaatatggcttgttcctcggcaccgcgcatccggcg
aaatttaaagagagcgtggaagcgattctcggtgaaacgttggatctgccaaaagagctg
gcagaacgtgctgatttacccttgctttcgcataacctgcccgccgattttgctgcgttg
cgtaaattgatgatgaatcatcagtaa

DBGET integrated database retrieval system