KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0175Help
Entry
c0175             CDS       T00106                                 

Gene name
folK
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00790  Folate biosynthesis
ecc01100  Metabolic pathways
Module
ecc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    c0175 (folK)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     c0175 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: AAN78669
UniProt: A0A0H2V466
Structure
PDB: 

Jmol
Position
complement(167802..168281)
Genome map
AA seq 159 aa AA seqDB search
MTVAYIAIGSNLASPLEQVNAALKALGDIPESRILAVSSFYRTPPLGPQDQPDYLNAAVA
LKTTLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMK
NRGFMLWPLFEIAPELVFPDGLSLVEALQAKGFNELDKW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacagtggcgtatattgccataggcagcaatctggcctctccgctggagcaggtcaat
gctgccctgaaagcattaggcgatattccagaaagccgcattcttgctgtttcttcgttt
taccgcaccccaccgctggggccgcaagatcaacccgattacttaaatgccgccgtcgcg
ctgaaaaccactcttgcccctgaagagctactcaatcacacacaacgtatcgaattgcag
caaggtcgcgtccgtaaagctgaacgctggggaccgcgcacgctggatctcgacatcatg
ctgtttggtaatgaagtaataaataccgaacgtctgaccgttccgcactacgatatgaaa
aatcgcggctttatgctgtggccactgtttgaaattgcgccggaattggtatttcctgat
ggcttatcattagttgaagctctacaggcaaaaggctttaatgaattagataagtggtaa

DBGET integrated database retrieval system