KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0331Help
Entry
c0331             CDS       T00106                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    c0331
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     c0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
301731..302651
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCKLIVLQLEVQLETVYHAIEFGKKNGIEVLLNPAPALRELDMSYACKCDF
FIPNETELEILTGMSVDTYDHIRLAARSLVDKGLNNIIVTMSEKGALWMTRDQEVHVPAF
KVNAVDTSGAGDAFIGCFSHYYVQSGDVEAALKKAALFAAFSVTGKGTQSSYPSIEQFNE
FLTLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacattgcagttattggttccaatatggtggatctcattacttacacgaatcagatg
cctaaagaaggagaaactctggaagcacctgccttcaaaatcggatgtggtgggaaaggt
gctaatcaagcggtggcggcggctaaattgaattcaaaagtcctgatgctgactaaagta
ggtgatgatatttttgcggataatactattcgtaatctcgaatcatggggaattaatacc
acttatgttgagaaggtcccctgtaccagcagtggtgttgcaccgatctttgttaatgcc
aactcgagcaatagtatattaataattaagggagcgaataaatttctttccccggaagat
atcgatcgagctgcagaagatctgaaaaaatgcaaattgatcgttttacaactggaagtt
caactggaaacagtttaccacgcgattgagtttggtaagaaaaatggtattgaagtgtta
ttaaatccggctccggcattgcgtgagttagatatgtcttatgcctgcaaatgtgatttc
tttatcccgaatgaaacagaactggaaatattaaccggtatgtcggttgatacttatgat
catattcgtttggccgcacgttcgttagttgataaagggctgaacaatattattgttacc
atgagcgaaaaaggcgcattatggatgacccgtgatcaggaagtccatgttcctgcattc
aaagtaaatgctgttgatactagtggcgctggtgacgcatttattggttgcttttcccat
tattatgttcaaagcggtgatgttgaagccgctttgaaaaaagccgctctctttgccgct
ttcagcgtcacagggaaaggtacgcaatcatcttatccgagtattgaacaatttaatgaa
tttttaaccttaaacgaataa

DBGET integrated database retrieval system