KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0793Help
Entry
c0793             CDS       T00106                                 

Gene name
nei
Definition
endonuclease VIII (EC:3.2.-.-)
Orthology
K05522  
endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ecc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
777002..777793
Genome map
AA seq 263 aa AA seqDB search
MPEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKSYQSRLIGQHVTHVETRGKALLTHFS
NDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKTILLYSASDIEMLTPEQLTTH
PFLQRVGPDVLDPNLTPEVVKERLLSPRFRNRQFAGLLLDQAFLAGLGNYLRVEILWQVG
LTGNHKAKDLNAAQLDALAHALLDIPRLSYATRGQVDENKYHGALFRFKVFHRDGEPCER
CGGIIEKTTLSSRPFYWCPGCQH
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaggcccggagatccgccgtgcagcggataacctggaggcggcgatcaaaggc
aaaccactaactgatgtctggtttgccttcccgcagttaaaatcttatcaatcacgactt
atcggtcaacacgttacccatgtggaaacgcgtggtaaggcgttgttaactcatttttcc
aacgacttaacgctctacagccataatcagctttacggcgtctggcgcgtggttgatacc
ggcgaagagccgcagaccacgcgagtactgcgggtaaaactgcaaacggctgacaaaacc
attctgctttatagcgcctcggatattgagatgttgactccggaacaactgaccacgcat
ccgtttttacaacgcgttggtcccgatgtgctggatccgaatctgacgccggaggtggta
aaggaacgattattgtcgccgcgctttcgtaaccgccagtttgctggattactgctcgat
caggcgtttctggcaggacttggcaattatttgcgggtggagatcctctggcaggttggg
ttgaccggaaatcataaagcgaaagatctcaatgcggcgcaactggatgcactcgcacac
gcgttactggatattccgcgactttcttacgctacgcggggccaggtggatgaaaacaaa
tatcatggggcgctgtttcgctttaaggtttttcatcgtgatggcgaaccgtgcgaacgc
tgtggcggcatcattgagaaaaccacgctgtcatcgcgcccgttttactggtgccctggc
tgccagcactag

DBGET integrated database retrieval system