KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0849Help
Entry
c0849             CDS       T00106                                 

Gene name
ybhC
Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    c0849 (ybhC)
   00500 Starch and sucrose metabolism
    c0849 (ybhC)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     c0849 (ybhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(827482..828765)
Genome map
AA seq 427 aa AA seqDB search
MNTFSVSRLALALAFGVTLTACSSTPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFA
SLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTHTTIQAAVDAAIIKRTNKRQYIAVMPG
EYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRHDVNPRGKYMPGKPAWY
MYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEF
RVVNSRTQQEAYVFAPATLSNIYYGFLAVNSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSAINEGFNTAKPWADAVISNRPFAGNTGSVDDNDEVQRNLNDTNYNRMWEYNNRGVGSK
VVAEAKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacattttcagtttcccgtctggcgctggcattggcttttggcgtgacgctgacc
gcctgtagctcaacaccgcccgatcaacgtccttctgatcaaaccgcgcctggtacctct
tcgcgcccgattctgtcggcaaaagaagcgcagaatttcgatgctcaacactattttgca
tccctgacaccaggtgcggcagcgtggaatccttccccgattaccctgcctgcgcaacct
gactttgttgtcggcccggcgggtactcaaggtgtaacgcataccacgattcaggcggcg
gtagatgcggcaattatcaagcgtaccaacaagcgccagtatattgccgtgatgcctggt
gagtatcagggaacggtgtatgtccctgccgctccgggtggaattactctgtacggtacg
ggtgaaaaaccgattgatgtgaagattgggctttcccttgatggtggcatgagccctgcc
gactggcgtcacgacgtcaacccgcgcggcaaatatatgccaggtaaaccggcgtggtat
atgtacgatagctgccagagtaaacgcagcgacagtatcggtgttctctgctctgcggtc
ttctggtcacaaaacaatggcctgcaactgcaaaacctgaccatcgaaaacacgctgggc
gatagcgtagatgcgggtaaccatccggcggtggcactgcgtactgatggcgacaaagtg
cagatcaataacgtcaacattctcggtcgtcagaacaccttctttgtcaccaacagcggt
gtgcagaaccgtctggaaacgaatcgtcagccacgtacgctggtgaccaacagctatatt
gaaggggatgtggatatcgtttctggtcgcggcgcagtggtgttcgataacaccgaattc
cgcgtggtgaactcccgtacccagcaagaagcgtatgtgtttgcaccggctacgctgtcc
aacatttactacggtttcctcgccgtaaacagccgtttcaatgcttccggtgatggcgtg
gcgcaactgggccgctcgctggatgttgatgccaataccaacggtcaggtagtgatccgt
gatagcgccatcaacgaaggttttaacacagccaaaccgtgggctgatgcggtgatctct
aatcgtccatttgcgggtaacaccggcagcgttgatgataacgacgaagtacagcgcaat
ctgaatgacactaactacaaccgcatgtgggaatacaataaccgcggcgtgggtagcaaa
gtggttgcagaggcgaagaagtag

DBGET integrated database retrieval system