KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c0957Help
Entry
c0957             CDS       T00106                                 

Definition
Fels-2 prophage: prophage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     c0957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
927205..927717
Genome map
AA seq 170 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDSVVSFAFNVGTGNAC
SSTLVKLLNQRRWADACRQLPRWVYVKGVFNQGLDNRRAREMAWCLQGAN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccgggttttcagcagctgcacacctccgtggaagggctgaaactgattgccgattac
gaaggctgtcgtctgcagccgtatcagtgcagcgcgggtgtatggactgacggcattggt
aatacgtcgggcgtcattcccggcaaaaccattacggaacgacaggcagcagaagggctt
atctccaacgtgctgcgtgtggagcgggcgctggaaagatgtgtgaagcaacagccgcca
caaaaggtgtatgactcggtggtgtcgtttgccttcaacgtggggacaggcaatgcctgc
agctccacgctggtgaaattgctcaatcagcggcgctgggcggatgcgtgccgacagttg
ccgcgctgggtttatgtaaaaggtgtgtttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgtttacagggagcaaactga

DBGET integrated database retrieval system