KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1436Help
Entry
c1436             CDS       T00106                                 

Definition
lysozyme from lambdoid prophage Qin (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345465..1345998
Genome map
AA seq 177 aa AA seqDB search
MNAKIRYGLSAAVLALIAVGAPAPDILDQFLDEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMRLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRRDQESALACWGIDQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaaaaatcagatacggcctgtcggctgccgttctggcactgattgccgtcggt
gcgcctgcgcctgatattctcgaccagtttctggatgaaaaagaaggtaaccacacaacg
gcataccgcgatggttccggtatatggaccatctgtcgtggtgccacaatggtggatggt
aagcccgtcataccgggaatgaggctgtcgaaggaaaaatgcgaccaggttaacgctatt
gaacgtgataaggcgctggcatgggtggagcgcaatattaaagtaccactgaccgaacca
cagaaagcgggtatagcgtcattctgtccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgccggtgatcgtaagggcgcatgcgaggcgattcgc
tggtggataaaagatggtgggcgcgattgccgcatacgttcaaataactgctatggacag
gttattcgtcgtgaccaggaaagcgcattagcctgttgggggatagatcagtga

DBGET integrated database retrieval system