KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1700Help
Entry
c1700             CDS       T00106                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00040  Pentose and glucuronate interconversions
ecc00052  Galactose metabolism
ecc00500  Starch and sucrose metabolism
ecc00520  Amino sugar and nucleotide sugar metabolism
ecc01100  Metabolic pathways
ecc01130  Biosynthesis of antibiotics
Module
ecc_M00362  Nucleotide sugar biosynthesis, prokaryotes
ecc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    c1700 (galU)
   00052 Galactose metabolism
    c1700 (galU)
   00500 Starch and sucrose metabolism
    c1700 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    c1700 (galU)
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     c1700 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAN80167
UniProt: P0AEP4
Structure
PDB: 

Jmol
Position
1536428..1537336
Genome map
AA seq 302 aa AA seqDB search
MAAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaatacgaaagtcaaaaaagccgttatccccgtagcgggattaggaacc
aggatgttgccggcgacgaaagccatcccgaaagagatgctgccacttgtcgataagcca
ttaattcaatacgtcgtgaatgaatgtattgcggctggcattactgaaattgtgctggtt
actcactcatctaaaaactctattgaaaaccactttgataccagttttgaactggaagca
atgctggaaaaacgtgtaaaacgtcaactgcttgatgaagtgcagtctatttgtccgccg
cacgtgactattatgcaagttcgtcaggggctggcgaaaggcctgggacacgcggtattg
tgtgctcacccggtagtgggtgatgaaccggtagctgttattttgcctgacgttattctg
gatgaatatgaatccgatttatcacaggataacctggcagagatgatccgccgctttgat
gaaacgggtcatagccagatcatggttgaaccggttgctgatgtgaccgcatatggcgtt
gtggattgcaaaggcgttgaattagcgccgggtgaaagcgtaccgatggttggcgtggtt
gaaaaaccaaaagcggatgttgcgccgtctaatctcgctattgtgggtcgttacgtactt
agcgcggatatttggccgttgctggcaaaaacccctcctggagctggtgatgaaattcag
ctcaccgacgcaattgatatgctgatcgaaaaagaaacggttgaagcctatcatatgaaa
gggaagagccatgactgcggtaataaattaggttacatgcaggccttcgttgaatacggt
attcgtcataacacccttggcacggaatttaaagcctggcttgaagaagagatgggcatt
aagaagtaa

DBGET integrated database retrieval system