KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1907Help
Entry
c1907             CDS       T00106                                 

Gene name
fdnI
Definition
(GenBank) Formate dehydrogenase-N gamma subunit
  KO
K08350  
formate dehydrogenase-N, gamma subunit
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    c1907 (fdnI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1744165..1744818
Genome map
AA seq 217 aa AA seqDB search
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFF
GIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSI
MSMIFVLLVTGVIIWRPYFAQYFPIQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSI
KGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtcgaaaatgattgtgcgcaccaaatttattgatcgcgcctgtcactggacc
gtggtgatttgcttcttcctggtggcgctgtccgggatttcgttcttcttcccgacgctg
caatggctgacgcaaaccttcggtacgccgcagatggggcgcattttgcacccgttcttc
ggcattgcgattttcgtcgcgctgatgtttatgtttgtgcgttttgtgcatcacaacatc
ccggataagaaagatattccgtggctgttgaacattgtcgaagtattaaaaggcaatgag
cacaaagtggcggatgtcggtaagtacaacgccgggcaaaagatgatgttctggtcaatc
atgagcatgattttcgtgctgctggtgaccggagtgattatctggcgtccgtactttgcg
cagtacttcccgatacaggttgtccgttatagcctgctgatccatgcggctgcgggtatc
atcctgatccacgccatcctgatccatatgtatatggcattctgggtaaaaggatcgatt
aaagggatgatcgaagggaaggtgagccgtcgctgggcgaagaaacaccatccgcgctgg
tatcgtgaaatcgagaaggcagaagcgaaaaaagagagtgaagaagggatataa

DBGET integrated database retrieval system