KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1910Help
Entry
c1910             CDS       T00106                                 

Definition
(GenBank) Hypothetical protein
  KO
K07334  
toxin HigB-1
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Prokaryotic defense system [BR:ecc02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   HigB-HigA
    c1910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1745328..1745600)
Genome map
AA seq 90 aa AA seqDB search
MNFRHKGLRDLFLLGKTSGVIPTQVKRLRHRLAVIDAACCLADIDMPGYRLHPLSGDRDG
IWAISVSGNWRITFEFVNGDAYILDYEDYH
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcagacacaagggattgcgtgacttgtttcttctcggcaaaacctccggcgtt
ataccgacgcaagtcaaacgattacgccaccgactcgctgtgattgatgcagcatgctgt
cttgctgatatcgatatgcccggttaccgactacatccgttaagcggcgatcgcgatgga
atttgggcgatatctgtctcgggtaactggcgaatcacatttgaattcgtcaatggcgat
gcatacatactggattacgaggactatcactga

DBGET integrated database retrieval system