KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1911Help
Entry
c1911             CDS       T00106                                 

Gene name
adhP
Definition
(GenBank) Alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00010  Glycolysis / Gluconeogenesis
ecc00071  Fatty acid degradation
ecc00350  Tyrosine metabolism
ecc00625  Chloroalkane and chloroalkene degradation
ecc00626  Naphthalene degradation
ecc01100  Metabolic pathways
ecc01110  Biosynthesis of secondary metabolites
ecc01120  Microbial metabolism in diverse environments
ecc01130  Biosynthesis of antibiotics
ecc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    c1911 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    c1911 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    c1911 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    c1911 (adhP)
   00626 Naphthalene degradation
    c1911 (adhP)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     c1911 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N Methyltransf_31 Phage_holin_2_1 GFA DUF2284
Motif
Other DBs
NCBI-ProteinID: AAN80370
UniProt: A0A0H2V7E3
Structure
PDB: 

Jmol
Position
complement(1745792..1746832)
Genome map
AA seq 346 aa AA seqDB search
MQNIIRKGGTMKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGD
KTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAG
YSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGL
GGLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAARIVQEKAGGAH
AAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDL
TEAFQFAAEGKVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacatcatccgaaaaggaggaactatgaaggctgcagttgttacgaaggatcat
catgttgacgttacggataaaacactgcgctcactgaaacatggcgaagccctgctgaaa
atggagtgttgtggtgtatgtcataccgatcttcatgttaagaatggcgattttggtgac
aaaaccggcgtgattctgggacacgaaggtattggtgtggtggcagaagttggccctggt
gttacttcattaaaaccaggcgatcgtgccagcgtggcgtggttctatgaaggatgcggt
cattgcgaatactgtaacagtggtaacgaaacgctctgccgttcagtaaaaaatgccgga
tacagcgttgatggcgggatggcggaagagtgcatcgtggtcgccgattacgcggtaaaa
gtgccagatggtctggactcggcggcggccagcagcattacctgtgcgggggtcactacc
tacaaagccgttaagctgtcaaaaattcgtccaggacagtggattgctatctacggtctt
ggcggtctgggtaacctcgccctgcaatacgcgaagaatgtctttaacgccaaagtgatc
gccattgatgtcaatgatgaacagttaaaactggcaaccgaaatgggtgcagatttagcg
attaactcacgcaccgaagacgccgccagaattgtgcaggagaaagccggtggcgctcac
gcagcggtggtgacagcggtagctaaagctgcgtttaactcggcggtggatgctgtccgt
gcaggtggtcgtgtcgtggctgtcggtctgccgccggagtctatgagcctggacatccca
cggctggtgctggatggtattgaagtggtcggttcgctggtcggcacgcgtcaggatcta
accgaagccttccagtttgccgccgaaggcaaagtggtgccgaaagtcgccctgcgtccg
ttagcggacatcaacaccatctttaccgagatggaagaaggcaaaatccgtggccgtatg
gtgattgatttccgtcgctaa

DBGET integrated database retrieval system