KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1911Help
Entry
c1911             CDS       T00106                                 

Gene name
adhP
Definition
(GenBank) Alcohol dehydrogenase, propanol-preferring (EC:1.1.1.1)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    c1911 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    c1911 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    c1911 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    c1911 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    c1911 (adhP)
   00626 Naphthalene degradation
    c1911 (adhP)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     c1911 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1745792..1746832)
Genome map
AA seq 346 aa AA seqDB search
MQNIIRKGGTMKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGD
KTGVILGHEGIGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAG
YSVDGGMAEECIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGL
GGLGNLALQYAKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAARIVQEKAGGAH
AAVVTAVAKAAFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDL
TEAFQFAAEGKVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacatcatccgaaaaggaggaactatgaaggctgcagttgttacgaaggatcat
catgttgacgttacggataaaacactgcgctcactgaaacatggcgaagccctgctgaaa
atggagtgttgtggtgtatgtcataccgatcttcatgttaagaatggcgattttggtgac
aaaaccggcgtgattctgggacacgaaggtattggtgtggtggcagaagttggccctggt
gttacttcattaaaaccaggcgatcgtgccagcgtggcgtggttctatgaaggatgcggt
cattgcgaatactgtaacagtggtaacgaaacgctctgccgttcagtaaaaaatgccgga
tacagcgttgatggcgggatggcggaagagtgcatcgtggtcgccgattacgcggtaaaa
gtgccagatggtctggactcggcggcggccagcagcattacctgtgcgggggtcactacc
tacaaagccgttaagctgtcaaaaattcgtccaggacagtggattgctatctacggtctt
ggcggtctgggtaacctcgccctgcaatacgcgaagaatgtctttaacgccaaagtgatc
gccattgatgtcaatgatgaacagttaaaactggcaaccgaaatgggtgcagatttagcg
attaactcacgcaccgaagacgccgccagaattgtgcaggagaaagccggtggcgctcac
gcagcggtggtgacagcggtagctaaagctgcgtttaactcggcggtggatgctgtccgt
gcaggtggtcgtgtcgtggctgtcggtctgccgccggagtctatgagcctggacatccca
cggctggtgctggatggtattgaagtggtcggttcgctggtcggcacgcgtcaggatcta
accgaagccttccagtttgccgccgaaggcaaagtggtgccgaaagtcgccctgcgtccg
ttagcggacatcaacaccatctttaccgagatggaagaaggcaaaatccgtggccgtatg
gtgattgatttccgtcgctaa

DBGET integrated database retrieval system