KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1915Help
Entry
c1915             CDS       T00106                                 

Definition
(GenBank) Hypothetical protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1749411..1749551
Genome map
AA seq 46 aa AA seqDB search
MIDIDAISLELYISGYLLWKFNLSAGIIFSPDFIRIILLILVLFLT
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
ttgattgatattgatgcaatatctcttgagttatatatttccggttatctattgtggaaa
tttaatttaagtgcaggaattatattttcgccggattttattcggattatcctgcttatc
ctcgtgctgtttctcacgtag

DBGET integrated database retrieval system