KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1916Help
Entry
c1916             CDS       T00106                                 

Gene name
osmC
Definition
(GenBank) Osmotically inducible protein C
  KO
K04063  
osmotically inducible protein OsmC
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1749589..1750020
Genome map
AA seq 143 aa AA seqDB search
MTIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACF
SMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDVIIQK
AKAGCPVSQVLKAEITLDYQLKS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccataagaaaggtcaggcacactgggaaggcgatatcaaacgcgggaaggga
acagtatctactgagagcggcgtgctgaaccaacagccgtatggatttaacacgcgtttt
gaaggcgaaaaaggaaccaaccctgaagaactgattggcgcagcgcatgccgcatgtttc
tcaatggcgctttcattaatgctgggggaagcgggattcacgccaacatcgattgatacc
accgccgatgtctcgctggataaagtggatgccggttttgcgattactaaaatcgcactg
aagagcgaagttgcggtgccgggtattgatgcctccacctttgacgtcattatccagaaa
gcaaaagcaggatgcccggtttctcaggtactgaaagcggaaattacgctggattaccag
ttgaaatcgtaa

DBGET integrated database retrieval system