KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1931Help
Entry
c1931             CDS       T00106                                 

Gene name
ydeQ
Definition
(GenBank) Hypothetical fimbrial-like protein ydeQ precursor
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1772498..1773412)
Genome map
AA seq 304 aa AA seqDB search
MGKTFSIKVLFGIYLLLIAGKVFAFSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDL
SQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVTYPFPLTTNTNVLDIGD
KTPMPLPLKLYITPVGAAGGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVM
PTGGCTVDSRNVTVNLPDFPGSAEIPLGVYCSSEQKLSFYLSGATTDSARQVFANTAPDA
TKASGVGVSLMRNGKTLATGENVSLGTVNKSKVPLGLSATYGQTGNKVAAGAVQSVIGVT
FIYE
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacattcagtataaaggtcctgttcggtatttatcttctattaattgcaggc
aaagtttttgccttcagttgtaatgtcgatggcgggtcaagtattggagcaggtacaacc
tctgtttatgttaatctcgatcctgtaatacaaccgggccagaatctggttgtagacttg
tctcagcatataagttgctggaatgattacggcggctggtacgacactgatcatataaac
ctggtacaaggatcagctttcgcaggctccctacagtcatataaaggatcactgtactgg
aataatgtgacctaccctttcccgttgacgacaaataccaacgtattggatattggtgat
aagacaccgatgccattaccgttaaaactctatattaccccagtcggagcggctggtgga
gttgtcataaaagcaggggaagttattgcccgtattcatatgtataaaattgccacgtta
ggaagcggaaatccgcgtaattttacgtggaatattatttcaaataacagtgttgttatg
ccaacaggcggttgcaccgttgatagtcgtaatgtcaccgtgaatctcccggactttcct
ggaagcgcagaaataccccttggtgtatattgctctagcgaacaaaagctctcattttat
ctttcgggtgccaccactgacagtgcccgacaagtgtttgctaacacagcaccagatgca
acaaaagcatcgggcgtgggtgtctctctgatgcgtaatggaaaaacactggcaacagga
gaaaatgtctccctggggacagtaaataaaagcaaagtacctctgggtttaagcgcaacc
tatggacaaacaggaaacaaggttgcagccggagccgtccagtcagtcattggtgtcact
tttatctatgaataa

DBGET integrated database retrieval system