KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1933Help
Entry
c1933             CDS       T00106                                 

Gene name
ydeS
Definition
(GenBank) Hypothetical fimbrial-like protein ydeS precursor
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1773988..1774518)
Genome map
AA seq 176 aa AA seqDB search
MKYNNIIFLGLCLGLTTYSALSADSVIKISGRVLDYGCTVSSDSLNFTVDLQKNSARQFP
TTGSTSPAVPFQITLSECSKGTTGVRVAFNGIEDAENNTLLKLDEGSNTASGLGIEILDG
NMRPVKLNDLHAGMQWIPLVPDQNNILPYSARLKSTQKSVNPGLVSASATFTLEFQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaataacattattttcctcggtttatgtctgggattaaccacctattctgct
ttatccgcagatagtgttattaaaattagcgggcgcgtcctcgattatggctgcacagtc
tcatcggattcgcttaattttaccgtagatctccaaaaaaacagtgccagacaatttcca
acgaccggtagcacaagtccagccgtcccttttcagattacgttaagtgaatgcagtaaa
gggacaacgggggttcgggttgcatttaacggtattgaggatgcagaaaataatactctg
ttgaaactagatgaaggaagcaatacggcctccggtttgggtatagaaatactggacgga
aatatgcgtccggtgaaattgaatgaccttcatgccgggatgcagtggatcccattggta
ccagatcagaacaatattttgccttactccgctcgtttgaagtcaactcagaagtccgtc
aatccaggactggtgagcgcttcggcaacatttacccttgaatttcaataa

DBGET integrated database retrieval system