KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1940Help
Entry
c1940             CDS       T00106                                 

Gene name
hipA
Definition
(GenBank) Protein hipA
  KO
K07154  
serine/threonine-protein kinase HipA [EC:2.7.11.1]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Enzymes [BR:ecc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     c1940 (hipA)
Protein kinases [BR:ecc01001]
 Serine/threonine protein kinases: Other group
  Bacterial family
   c1940 (hipA)
Prokaryotic defense system [BR:ecc02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   HipA-HipB
    c1940 (hipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1781779..1783197)
Genome map
AA seq 472 aa AA seqDB search
MVMPKLVTWMNNQRVGELTKLANGAHTFKYAPEWLASRYARPLSLSLPLQRGNITSDAVF
NFFDNLLPDSPIVRDRIVKRYHAKSRQPFDLLSEIGRDSVGAVTLIPEDETVTCPIMAWE
KLTEARLEEVLTAYKADIPLGMIREENDFRISVAGAQEKTALLRIGNDWCIPKGITPTTH
IIKLPIGEIRQPNATLDLSQSVDNEYYCLLLAKELGLNVPDAEIIKAGRVRALAVKRFDR
RWNTERTVLLRLPQEDMCQTFGLPSSVKYESDGGPGIAQIMAFLMGSSEALKDRYDFMKF
QVFQWLIGATDGHAKNFSVFIQAGGSYRLTPFYDIISAFPVLGGTGIHISDLKLAMGLNA
SKGKKTAIDKXYPRHFXATAKVLKFPEVXMHEILXDFARMIPAALDNVKNSLPXDFPEXV
VTAVETNVLRLHGRLSPRIXYXVRYGVLVVVNEQNNHEPPTTGFSLGLCWCA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtggtaatgcctaaactagtcacttggatgaacaaccagcgggtaggcgagttaacgaag
ttagccaacggcgcgcacacctttaagtatgcacctgagtggttagccagccgttatgcc
agaccgttgtcactttcgctgccattgcagagggggaatatcacctctgatgccgtattt
aacttcttcgataacctgttacccgatagcccgattgtacgtgaccggatcgttaaacgt
tatcatgctaaatccagacaaccgtttgatttattgtcagaaatagggcgagatagcgtt
ggtgccgtgacgttaatccccgaagatgaaaccgtaacgtgtccgataatggcatgggaa
aagcttactgaagccagacttgaagaagtattaacggcttataaagcagatatcccgtta
ggcatgattagagaagaaaatgactttcgcatctcggttgctggcgcacaggagaagact
gcgctgctcagaataggcaatgactggtgcattccgaagggaataacgccaacgacgcac
attatcaaattgccgattggcgaaatcagacagcccaatgcgacgctcgatcttagccaa
agcgttgataatgagtattactgtttgctgctggcgaaagaactcgggttgaatgttccg
gacgcagaaatcattaaagcgggaagggtgcgcgcgttagcggtcaaacgttttgacagg
cgttggaatactgagcgaacggttttacttcgcttgccacaggaggatatgtgccagaca
ttcggtttaccttcatcggtgaaatatgaatcagatggaggccccggtatcgcgcaaatt
atggcttttttgatggggtccagcgaggcgctgaaagatcgctatgattttatgaagttt
caggtcttccagtggttgattggcgcaacagatggccatgcaaaaaacttctccgtattt
attcaggctggcggcagttatcggctcacaccattttatgacatcatttcggcatttccg
gtccttggcggtacgggaatacacatcagcgatctcaaactggcaatggggcttaacgca
tccaaaggcaaaaaaacggcaatcgataaawtttatccgcgacattttstggcgacagca
aaggtgctgaaattcccggaagtgcakatgcatgaaatcctgagkgactttgccagaatg
attccggcagcactggataacgtgaagaattcattaccgncagattttccggagamcgtg
gtgacggcagttgaaaccaatgtgttgaggttgcacggtcggttaagccccagaatackg
tatyaagtaagatatggggttttggtcgttgttaatgagcagaacaatcatgaaccgcca
acgactggattctcccttggtttatgttggtgcgcataa

DBGET integrated database retrieval system