KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1949Help
Entry
c1949             CDS       T00106                                 

Gene name
yneJ
Definition
(GenBank) Hypothetical transcriptional regulator yneJ
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1791712..1792593
Genome map
AA seq 293 aa AA seqDB search
MDLTQLEMFNAVAEAGSITQAAAKVHRVPSNLTTRLRQLETELGVDLFIRENQRLRLSPA
GHNFLRYSQQILTLVDEARSVVAGDEPQGLFSLGSLESTAAVRIPATLAEFNRRYPKIQF
SLSTGPSGTMLEGVLEGKLNAAFIDGPINHTAIDGIPVYREELMIVTPQGHAPVTRASQV
NGSNIYAFRANCSYRRHFESWFHADGAAPGTIHEMESYHGMLACVVAGAGIALIPRSMLE
SMPGHHQVEAWPLAEQWRWLTTWLVWRRGAKTRPLEAFIQLLDAPDSAKQGYQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggatctgacccaactggagatgttcaacgcggttgccgaagctggcagcattacccag
gctgcagcaaaagtgcatcgcgtgccgtcgaatctcactacccgtctacgtcagcttgaa
acagaactaggggttgatctgtttattcgcgagaatcagcgtttacgtctctcgcctgcc
gggcataactttttacgctatagccaacaaattctcacgttagtggatgaagcgcggagc
gttgtcgctggcgatgagccgcaaggtttattttctctgggatcgctggaaagcaccgct
gcagtgcgcattccggccacgctggcggaatttaaccgtcgttatcccaaaattcagttt
tcactttccaccggcccttccggcactatgctggaaggtgtgctggagggaaaactgaat
gcggcatttattgatgggcccattaaccatactgccattgacgggataccggtataccgc
gaggaactgatgatcgtcacgccacaaggacatgcgccagtaacccgtgccagtcaggtg
aatggcagtaacatttatgccttccgcgccaattgttcgtatcgtcgccacttcgaaagc
tggtttcatgctgacggtgccgctccgggaactattcacgagatggagtcttatcacggg
atgttggcctgtgtggtcgcaggagcaggcattgcgcttattccacgctcaatgctggaa
agtatgccggggcatcaccaggttgaagcgtggccgttagctgagcaatggcgttggtta
acaacctggctggtctggcgtcgtggtgcgaaaacgcgtccgcttgaggcatttattcaa
ctgctggatgcgcctgactcggcaaaacagggttaccaatga

DBGET integrated database retrieval system