KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1951Help
Entry
c1951             CDS       T00106                                 

Gene name
marC
Definition
(GenBank) Multiple antibiotic resistance protein marC
  KO
K05595  
multiple antibiotic resistance protein
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Transporters [BR:ecc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   c1951 (marC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1794147..1794812)
Genome map
AA seq 221 aa AA seqDB search
MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMSSAERNRQSLMASVYVFAIMMVAYY
AGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSANIA
FVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGA
IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttagatttgtttaaagcaataggcctggggctggtggtgttactgccgttagctaac
ccattgacaactgtcgcgttatttcttggcctggcaggcaacatgagcagtgccgaacgt
aatcgtcagtcgttgatggcctcggtgtacgtatttgccatcatgatggtggcgtattac
gccgggcaactggtgatggatacatttggcatttcgattcccggtctgcgaattgcaggc
ggcttaatcgtcgcgtttatcggttttcggatgctctttccgcaacagaaagcgattgat
tcaccggaagcgaaaagcaagtcggaagagctggaagatgaacccagtgccaatattgct
tttgtaccactggcaatgccaagtaccgccggtccgggaaccattgcgatgattattagc
tcggcctccacagtgcgtcagagttcaaccttcgctgattgggtactgatggttgcgccg
ccgctgatctttttcctggtggcggttattttgtggggaagtctacgcagctctggcgca
attatgcggctggtgggcaagggtggtattgaagcgatctcccgtctgatgggattcctg
ctggtatgtatgggcgtgcagtttattattaacggcatcctggaaatcattaaaacgtat
cattaa

DBGET integrated database retrieval system