KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1953Help
Entry
c1953             CDS       T00106                                 

Gene name
marA
Definition
(GenBank) Multiple antibiotic resistance protein marA
  KO
K13632  
AraC family transcriptional regulator, mar-sox-rob regulon activator
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Cationic antimicrobial peptide (CAMP) resistance
Module
Multidrug resistance, efflux pump AcrAB-TolC/SmeDEF
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    c1953 (marA)
Transcription factors [BR:ecc03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    c1953 (marA)
Antimicrobial resistance genes [BR:ecc01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, repression of porin OmpF [MD:M00746]
    c1953 (marA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1795473..1795862
Genome map
AA seq 129 aa AA seqDB search
MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYI
RSRKMTEIAQKLKESNEPILYLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRF
LHPLNHYNN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgtccagacgcaatactgacgctattaccattcatagcattttggactggatc
gaggacaacctggaatcgccactgtcactggagaaagtgtcagagcgttcgggttactcc
aaatggcacctgcaacggatgtttaaaaaagaaaccggtcattcattaggtcaatacatc
cgtagccgtaagatgacggaaatcgcgcaaaagctgaaggaaagtaacgagccgatactc
tatctggcagaacgatatggcttcgagtcccaacaaactctgacccgaaccttcaaaaat
tactttgatgttccgccgcataaataccggatgaccaatatgcagggtgaatcgcgcttt
ttacatccattaaatcattacaacaactag

DBGET integrated database retrieval system