KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1955Help
Entry
c1955             CDS       T00106                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    c1955 (celA)
Enzymes [BR:ecc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     c1955 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1796169..1797614)
Genome map
AA seq 481 aa AA seqDB search
MCMSGFKKDFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGVIDGLNYP
NHEAIDFYHRYKTDIQLFAGMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECL
KQGMEPVVTLSHFEMPYHLVTKYGGWRNRKLIDFFIHFASTVFTRYKEKVKYWMTFNEIN
NQVNFSESLCPFTNSGILYSPEEDLNEREQIMYQAVHYELVASALAVQTGKLINPEFNIG
CMIAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPD
DNAILARGCVDFIGFSYYMSFTTQFSPDNPQLDYVEPRDLVSNPYIDTSEWGWQIDPAGL
RYSLNWFWDHFQLPLFIVENGFGAVDQRQADGTVNDHYRIDYFSSHIREMKKAVVEDGVD
LIGYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGEN
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
ttgtgtatgtcaggatttaaaaaagattttttatggggcggtgcggtagccgcacatcaa
ttggaaggtggctggaatgaaggaggaaaaggcatcagtatcgctgatgtaatgactgct
ggcgctcacggggtgccgcgtgaagtgacagaaggcgttatcgacggacttaattatccc
aatcatgaagcaattgatttttatcatcgctataaaacagatattcagttatttgccggg
atgggattcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgac
gaacaggagccgaatgaagagggtttacaattttatgatgatctcttcgatgaatgcctg
aagcagggaatggaacctgtggtgacgctttcgcattttgagatgccttatcatctggtg
acaaaatatggtggctggcgaaaccgtaaactgatcgacttttttatccacttcgcatca
acggtcttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaat
aatcaggtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcg
ccagaggaagatctcaatgagcgcgaacaaataatgtaccaggcggtacattatgagtta
gttgccagtgccctggcggtacagactggaaaactgatcaatcctgaatttaatatcggc
tgtatgattgctatgtgccccatctatcctctgacgtgtgcacccaacgatatgatgatg
gccacgaaagcgatgcatcgtcgttactggtttactgatgttcatgctcgtggatattat
ccgcaacatatgctgaattactttgcaaggaaaggattcaacctcgatatcacaccagat
gataacgcgattcttgccagaggttgtgtcgactttatcggctttagctactacatgtct
tttacgacgcaattttcgccagataatccgcaactggattatgttgaaccacgagatttg
gtcagcaacccttatatcgatacatccgaatggggatggcaaattgatccggcagggcta
cgttattcactcaactggttctgggatcatttccagttgccgctgtttattgtcgaaaat
ggatttggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcatt
gattacttttcctcccatattcgggaaatgaaaaaagccgtagttgaagatggtgttgac
ttaattggctacaccccgtggggttgcattgacctggtttctgccggaacaggagaaatg
aaaaaacgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaa
cggatacgtaaagcatcgttttactggtatcgggatctcatcgccaacaatggcgaaaat
atatga

DBGET integrated database retrieval system