KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1958Help
Entry
c1958             CDS       T00106                                 

Definition
(GenBank) Putative conserved protein
  KO
K02761  PTS system, cellobiose-specific IIC component
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
ecc00500  Starch and sucrose metabolism
ecc02060  Phosphotransferase system (PTS)
Module
ecc_M00275  PTS system, cellobiose-specific II component
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    c1958
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    c1958
Transporters [BR:ecc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Cellobiose-specific II component [MD:M00275]
    c1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC
Motif
Other DBs
NCBI-ProteinID: AAN80415
UniProt: A0A0H2V7H5
Position
complement(1799700..1801061)
Genome map
AA seq 453 aa AA seqDB search
MGCINIQDNRYKKMGLMASFERGMERFLVPVAIKLNSQKHVAAVRDGFVFTFPIIMASSL
IILINFAILSPDGFIAGLLHLNSIFPNLEKAQAIFTPVMNGSVNIMSIMIAFLVARNVAI
SYEQDDLLCGLTAIGAFFIVYTPYQMIDGQAFLTTKYLGAQGLFVAVIVALITSEIFCRL
ARNPKITITMPAAVPPAVARSFKVLLPIFFVMVFFSALNYCLTLISPAGLNDLIYTLIQT
PLKHMGTNIFAVIILGAVGNFLWVLGIHGPNTTSAIRETVFSEANLENLSWAAQHGTTWG
APYPITWTSINDAFANCGGSGMTLGLLLAIFIASKRAEYRDLAKMSFIPGIFNINEPIMF
GLPIVLNPIMMVPFIMVPIVNCAIGYFFVSMEIIPPVAYAVPWTTPGPLIAFLGTGGNWL
ALLVGFLCLGVATMIYLPFVIAANKVNNMTTNG
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
ttgggatgtataaatatccaggacaacaggtataaaaaaatgggattaatggcatcattc
gaacgtggaatggaacgttttcttgttccagttgctatcaagttaaactcacaaaaacat
gttgcagcggtgagagatggattcgtttttacgtttccaattatcatggcaagctcatta
attatattaattaactttgccatattatcgcccgacggttttattgccggattactgcat
ctgaacagcattttccccaaccttgaaaaagcacaagctatttttactccggtaatgaat
ggttctgtaaatatcatgtcaattatgattgctttcctggtcgccaggaatgtggcgatt
agctatgagcaagatgatcttttatgcggattaacggcaataggagcattttttattgtt
tataccccataccagatgatagatgggcaggcattcctgacgaccaaatatctcggcgcg
caggggttgtttgttgctgttatcgttgcattgatcaccagtgaaatattttgtcgctta
gctcgaaaccccaaaatcaccataacgatgccggcagctgtacctcctgcggtagcgcgt
tcatttaaagttttattgccaatattttttgtcatggtgttcttttccgcacttaattat
tgcctgacattgatatccccggcaggattaaatgatctcatttacacattaatccagacg
ccgctcaaacatatgggaacgaatatctttgcggtaattatcctgggggctgtgggtaat
ttcctctgggtgctggggatccacggacctaatacaacgtcggcaattcgagaaaccgtt
ttttctgaggctaatctggagaatctctcctgggccgctcaacacggcactacctggggc
gcgccatatccgattacctggacttctattaatgatgcattcgccaactgcggcggttca
ggtatgacgttggggttattgttggctatttttatcgcttctaagcgtgcggaataccgt
gatctggcaaaaatgtcatttatccccggtattttcaatatcaatgaaccgataatgttc
ggccttcctattgtacttaaccccatcatgatggtgccgtttattatggttcccattgtt
aactgtgccattggttacttctttgtttcgatggaaattattccaccggttgcttatgcc
gtgccctggactacgcccggacctttaattgctttcctcggaaccgggggaaactggctg
gcattactggttggttttttatgtttaggtgtggcgacaatgatctatttaccttttgtt
atcgccgccaacaaagtcaataacatgacaactaacggataa

DBGET integrated database retrieval system