KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1960Help
Entry
c1960             CDS       T00106                                 

Definition
(GenBank) Putative conserved protein
  KO
K03482  
GntR family transcriptional regulator, glv operon transcriptional regulator
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Transcription factors [BR:ecc03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    c1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1801647..1802345
Genome map
AA seq 232 aa AA seqDB search
MIFQKIARLLKSEINGNSWHVGDLLPSEAELAVRYNVSRNTLRKALSLLEGEGIIHRKHG
SGTYIQKKNFVAHIDHMNSFSEIAHKSGKEAGSQIMKFEVQDASPTIATELNLVTGEQVY
YIKRLRFIEDNAAQLEETWMSVARFPDLTVSHMQKSKFSYIENECGIKIIGTFETFSPTF
PTPEIASILRISPRDPILKIQTQAVDSNSIPLDYSLLYSNIFEFQVKYFFPR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgatttttcaaaagattgcccgcttacttaaatccgagatcaatggcaattcatggcat
gttggtgatttgttgccgtcagaagcggaactcgctgttcgttataatgtttcgcgtaat
accctgcgtaaggcattatccctgctggaaggcgaaggaattattcacagaaagcatggt
tcaggaacatacattcaaaaaaagaattttgttgcacacattgatcacatgaacagtttc
agtgaaattgcacataaaagcggcaaagaggcaggaagtcagattatgaaatttgaagtg
caggatgcttctcctactattgcgactgagctgaatttagtgactggtgagcaggtttat
tacataaagagactgcgattcattgaggataatgcagcacaattagaagaaacgtggatg
tcagtggcacgttttcctgatttaaccgtatcgcatatgcaaaaatccaaattttcgtat
attgagaacgaatgcgggatcaaaatcattggcacctttgaaactttctccccgactttt
cctacccctgaaatcgccagtattttacggatcagcccacgggatcccatacttaaaatt
cagacccaggctgtggatagtaactctattccgctggattattcgttactttacagcaat
attttcgagttccaggtaaagtactttttcccgcgataa

DBGET integrated database retrieval system