KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1967Help
Entry
c1967             CDS       T00106                                 

Gene name
ydfZ
Definition
(GenBank) Hypothetical protein ydfZ
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YdfZ Nairovirus_M
Motif
Other DBs
NCBI-ProteinID: AAN80427
UniProt: P64464
Position
1810390..1810593
Genome map
AA seq 67 aa AA seqDB search
MTTYDRNRNAITTGSRVMVSGTGHTGKILSIDTEGLTAEQIRRGKTVVVEGCEEKLAPLD
LIRLGMN
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctacgatcgtaaccgtaacgcaatcaccactggcagccgtgttatggttagc
ggcaccggtcacactggcaagatcctgtcgattgatactgaaggtctgaccgctgagcaa
atccgccgcggaaaaaccgtagttgttgaaggttgtgaagagaaactggcaccactggac
ctgattcgtctcggcatgaactaa

DBGET integrated database retrieval system