KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1973Help
Entry
c1973             CDS       T00106                                 

Gene name
ynfB
Definition
(GenBank) Hypothetical protein ynfB precursor
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1816515..1816856
Genome map
AA seq 113 aa AA seqDB search
MKITLSKRIGLLAFLLPCALALSTTVHAETNKLVIESGDSAQSRQRAAMEKEQWNDTRNL
RQKVNKRTEKEWDKADAAFDNRDKCEQSANINAYWEPNTLRCLDRRTGRVIIP
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcactctcagcaaacgaatcggcctgctcgcttttctgctgccttgcgcactg
gcattgagcacaactgttcatgccgaaactaacaaactggtgattgagtctggcgacagt
gcacaaagccgccagcgcgccgctatggaaaaagagcaatggaatgacacgcgtaatctg
cgccagaaagtgaataaacgcactgaaaaagagtgggataaagccgacgctgcttttgat
aaccgcgataaatgtgagcaaagcgccaacatcaatgcctactgggagccaaatactttg
cgctgcctggaccgtcgaactggccgcgttattatcccctaa

DBGET integrated database retrieval system