KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1976Help
Entry
c1976             CDS       T00106                                 

Gene name
ynfD
Definition
(GenBank) Hypothetical protein ynfD precursor
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1818230..1818577
Genome map
AA seq 115 aa AA seqDB search
MLCLKKLSSRKELMMKLSTCCAALLLALASPAVFAAPGSCERIQSDISQRIINNGVPESS
FTLSIVPNDQVDQPDSQVVGHCANDTHKILYTRTTSGNVSAPAQSTQDNAPAEPQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgctatgcttaaagaagttatcttcgcgtaaggagcttatgatgaaactctcaacctgc
tgtgccgcgcttctgctcgccctcgcctcacccgcggtattcgccgcgccgggatcctgt
gagcgcatacagagcgatatatcacagcgcattatcaataatggcgtacccgaaagcagc
ttcacgttaagtattgtacccaatgaccaggttgatcagcctgattcccaggtcgtcggg
cattgcgctaatgatacgcataaaattctctacacccgtaccaccagcggtaacgtctct
gctcccgcgcagtctacccaggataacgcgcctgctgaaccgcagtaa

DBGET integrated database retrieval system