KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1978Help
Entry
c1978             CDS       T00106                                 

Gene name
ynfF
Definition
(GenBank) Probable dimethyl sulfoxide reductase chain ynfF precursor
  KO
K07310  
Tat-targeted selenate reductase subunit YnfF [EC:1.97.1.9]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    c1978 (ynfF)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.9  selenate reductase
     c1978 (ynfF)
Transporters [BR:ecc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   c1978 (ynfF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1821260..1823686
Genome map
AA seq 808 aa AA seqDB search
MMKIHTTEALMKAEISRRSLMKTSALGSLALASSAFTLPFSQMVRAAQAPVEEKAVWSSC
TVNCGSRCLLRLHVKDDTVYWVESDTTGDDVYGNHQVRACLRGRSIRRRMNHPDRLKYPM
KRVGKRGEGKFERISWDEALDTISDNLRRILKDYGNEAVHVLYGTGVDGGNITNSNVPYR
LMNSCGGFLSRYGSYSTAQISAAMSYMFGANDGNSPDDIANTKLVVMFGNNPAETRMSGG
GVTYYVEQARERSNARMIVIDPRYNDTAAGREDEWLPIRPGTDGALACAIAWVLITENMV
DQPFLDKYCVGYDEKTLPANAPRNAHYKAYILGEGPDGIAKTPEWAAKITSIPAEKIIQL
AREIGSAKPAYICQGWGPQRHSNGEQTSRAIAMLSVLTGNVGINGGNSGVREGSWDLGVE
WLPMLENPVKTQISVFTWTDAIDHGTEMTAPRDGVRGKEKLDVPIKFLWCYASNTLINQH
GDINHTHEVLQDDSKCEMIVGIDHFMTASAKYCDILLPDLMPTEQEDLISHESAGNMGYV
ILAQPATSAKFERKPIYWMLSEVAKRLGPDVYQTFTEGRSQHEWIKYLHAKTKERNPEMP
DYEEMKTTGIFKKKCPEEHYVAFRAFRVDPQANPLKTPSGKIEIYSERLAKIADTWELKK
DEIIHPLPAYTPGFDGWDDPLRKTYPLQLTGFHYKARTHSSYGNIDVLQQACPQEVWINP
IDAQARGIRHGDTVRVFNNNGEMLIAAKVTPRILPGVTAIGQGAWLKADMFGDRVDHGGS
INILTSHRPSPLAKGNPSHSNLVQIEKV
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatccataccacagaggcgctcatgaaggctgaaatcagccgtagaagtctg
atgaaaacctccgcacttggcagtctcgcgctggcaagcagtgctttcactttgccgttt
tcccaaatggtccgagcggcacaggcaccggtagaagagaaagcggtctggagttcctgc
accgttaactgcgggagccgctgtctgttacgtttgcatgtgaaagatgacaccgtgtac
tgggtggagtctgatacgacaggtgacgacgtctacggtaatcatcaggttcgagcgtgt
ttacgcgggcgctctatccgtcgacggatgaatcatcctgataggttgaaatatcccatg
aagcgcgtcggcaagcgcggtgaaggtaaatttgaacggataagttgggatgaagccctg
gataccatcagtgataatcttcggcggatcctaaaagattacggcaatgaggctgtacat
gtcctgtacggaacaggcgtagatggcggaaacatcaccaactcgaacgtcccgtaccgt
ctgatgaactcttgcggtggttttctcagtcgctatggtagctacagtaccgcacagatc
agtgccgcgatgagttatatgttcggtgccaatgatggcaacagcccggatgatatcgcc
aatacgaaactggtcgttatgttcggaaataacccggcagaaacgcggatgagcggcggt
ggtgtcacttactacgtcgagcaagcccgcgaacgttcaaatgcacgcatgatcgtcatc
gatccacgttataacgacacagctgccggacgtgaagatgaatggctgcccattcgccct
ggcaccgatggcgcactggcctgtgcgattgcctgggtactgattactgaaaacatggtc
gatcagccatttctcgacaaatattgtgttggttacgatgagaaaacgctgcccgccaac
gcaccacgtaacgcgcattataaagcctatattctgggcgaagggcctgacggcatagct
aaaacgccggaatgggcagcaaaaatcaccagcataccggcagaaaaaattatccagttg
gcacgagagatcggttcagcaaaacctgcttatatttgtcagggttgggggccacaacga
cactccaacggcgaacaaacgtcccgcgctattgccatgctttccgttctcaccggtaac
gtcggcataaacggcggcaactcaggtgtacgcgaaggtagctgggatctgggggtagaa
tggttaccgatgctcgagaatcctgttaaaacgcagatttccgtctttacatggacagat
gctatcgaccatggtacggaaatgaccgcgccccgtgatggtgttcgtggaaaagaaaaa
ctggatgtccccatcaagtttttatggtgctacgccagtaacacattgatcaatcaacat
ggcgacatcaatcacacccatgaggtgcttcaggatgacagcaagtgcgagatgattgtt
ggcattgaccacttcatgactgcctcggctaagtattgcgatatcctgttacccgacctg
atgccaacagagcaagaagacctcatctctcatgagtctgccgggaatatgggctatgtg
atcctcgcccaacccgcaacctcagcaaaatttgaacgcaaacccatctactggatgctg
agtgaagtcgccaaacgcttaggaccagacgtttatcaaacctttactgaaggtcgcagt
cagcatgaatggatcaaatatctccatgcgaaaacgaaggaacgtaaccctgagatgccc
gactacgaggagatgaaaacgaccgggatctttaagaaaaaatgcccggaagaacactac
gtcgctttccgcgcattccgtgtagatccacaggcaaacccattgaaaacaccttcggga
aaaatcgaaatttattctgaacgactggcgaagattgcggatacctgggaattgaaaaaa
gatgaaattattcatcctcttccagcttatacgccaggttttgatggctgggacgatccc
ctgcggaaaacttatccactgcagttaacgggcttccactacaaagcgcgtacccactcc
agttacggcaatattgatgtattacagcaggcctgcccacaagaggtgtggatcaacccc
attgatgctcaggcacgcggtatccgtcatggcgataccgtgcgggtatttaacaataat
ggagaaatgctgattgccgcaaaagtgactccgcgtattctgcctggcgttaccgccatc
gggcaaggtgcttggcttaaagcggatatgtttggtgaccgggtcgatcacggcggcagt
atcaatattctgacctctcaccgcccttcaccgctggcaaagggaaacccgtcgcacagc
aatcttgtccagatcgaaaaggtttaa

DBGET integrated database retrieval system