KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1979Help
Entry
c1979             CDS       T00106                                 

Gene name
ynfG
Definition
(GenBank) Probable anaerobic dimethyl sulfoxide reductase chain ynfG
  KO
K07311  
Tat-targeted selenate reductase subunit YnfG
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Transporters [BR:ecc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   c1979 (ynfG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1823697..1824314
Genome map
AA seq 205 aa AA seqDB search
MTTQYGFFIDSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFA
YYLSISCNHCDDPACTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEK
GHMTKCDGCYSRVAEGKQPICVESCPLRALEFGPIEELRQKHGTLAAVAPLPRAHFTKPN
IVIKPNANSRPTGDTTGYLANPEEV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacaatatggattttttatcgattccagccgctgtactggctgtaaaacctgc
gaactggcgtgcaaagattttaaagatcttggcccggaagtcagtttccgccgtatttat
gaatatgctggcggcgactggcaggaagataatggcgtctggcaccagaacgtgttcgct
tattatctctccatctcctgtaaccattgcgatgaccccgcatgtacaaaagtctgcccc
agcggtgcaatgcataagcgtgaagatggtttcgtggtggttgatgaagatgtttgtatc
ggctgccgctactgccacatggcttgtccgtacggcgcgccacagtacaatgctgaaaaa
gggcacatgacgaagtgcgatggttgttattcgcgcgtcgccgaggggaaacaacccata
tgtgtcgaatcctgcccactgcgtgcacttgagttcggtccaattgaagaattgcgccag
aagcacggcactctggctgccgtcgcgccactgccgcgcgcgcatttcacaaaacccaat
atcgttatcaaacctaacgccaacagccgcccgaccggcgataccactggttatctggct
aatccggaggaagtgtaa

DBGET integrated database retrieval system