KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1981Help
Entry
c1981             CDS       T00106                                 

Gene name
ynfH
Definition
(GenBank) Anaerobic dimethyl sulfoxide reductase chain ynfH
  KO
K07312  
Tat-targeted selenate reductase subunit YnfH
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Transporters [BR:ecc02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   c1981 (ynfH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1824316..1825170
Genome map
AA seq 284 aa AA seqDB search
MGNGWHEWPLVIFTVLGQCVVGALIVSGIGWFAAKNNADRQHIIRGMFFLWLLMGIGFIA
SVMHLGSPLRAFNSLNRIGASGLSNEIAAGSIFFAVGGLWWLVAVIGKMPQALGKLWLLV
SMALGIIFVWMMTCVYQIDTVPTWHNGYTTLAFFLTVLLSGPILAATILRAARVTFNTTP
FAIISILALIACAGLIVLQGLSLASIHSSVQQASALVPDYASLQVWRVVLLCAGLGCWLC
PLIRRREPHVAGLVLGLILILGGEMIGRVLFYGLHMTVGMAIAG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggatggcatgaatggccactggttatctttaccgtattgggtcaatgcgta
gtaggcgcgctgattgttagcggaattggctggttcgccgccaaaaataacgcagaccgt
cagcacattattcgtggcatgtttttcctctggctgttgatgggcatcgggtttattgcc
tctgtcatgcacctgggatcgccactgcgggcgtttaactcgctgaatagaatcggagct
tctggtctgagtaacgagattgctgccggttccatattttttgccgttggcggattatgg
tggctggtggcggtcatcggtaaaatgccgcaagcgttggggaaactctggttacttgtc
agcatggcgctcggcatcattttcgtctggatgatgacctgcgtgtatcaaatcgacact
gtgccaacctggcataacggttacactacgctggctttcttcctgacggtattgttgagc
ggtccaatacttgctgccacaattctacgtgcagcccgcgttacatttaataccacacca
tttgccatcattagcattctggcgctgatcgcttgtgccgggttgattgtgctgcaaggt
ttgtctctggcgtctattcactcatccgtacaacaagccagcgcactggtaccagattac
gcctccttacaggtctggcgtgtggtattgttatgcgcaggtctaggatgctggctttgt
ccgctcattcgtcgccgtgaacctcacgttgccggacttgttctggggttaatcctcatt
cttggcggtgagatgatcgggcgtgtgctcttttatggcctgcacatgacagtaggaatg
gctattgcaggttaa

DBGET integrated database retrieval system