KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1985Help
Entry
c1985             CDS       T00106                                 

Gene name
mlc
Definition
(GenBank) Mlc protein
  KO
K15545  
transcriptional regulator of PTS gene
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Brite
Transcription factors [BR:ecc03000]
 Prokaryotic Type
  Other transcription factors
   Others
    c1985 (mlc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1828051..1829271)
Genome map
AA seq 406 aa AA seqDB search
MVAENQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLV
QELEIKEAGNRGRPAVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKD
DSPLLERIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGE
ALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSS
SLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMSSMLHGQPLTVDSL
CQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIR
QQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtggttgctgaaaatcagcctgggcacattgatcaaataaagcagaccaacgcgggcgcg
gtttatcgcctgattgatcagcttggtccagtctcgcgtatcgatctttcccgtctggcg
caactggctcctgccagtatcactaaaattgtccgtgagatgctcgaagcacacctggtg
caagagctggaaatcaaagaagcggggaaccgtggccgtccggcagtggggctggtggtt
gaaactgaagcctggcactatctttctctgcgcattagtcgcggggagattttccttgct
ttgcgcgatctgagcagcaaactggtagtggaagagtcgcaggaactggcgttaaaagat
gactcgccattgctggagcgtatcatttcccatatcgatcagttttttatccgccaccag
aaaaaacttgagcgtctgacttcgattgccataaccttgccgggaattattgatacggaa
aatggtattgtacatcgcatgccgttctacgaggatgtaaaagagatgccgctcggcgag
gcgctggagcagcataccggcgtaccggtttatattcagcatgatatcagcgcatggacg
atggctgaggccttgtttggtgcctcacgcggggcgcgcgatgtgattcaggtggttatc
gatcacaacgtgggggctggcgtcattaccgatggtcatctgctacacgcaggcagcagt
agcctcgtggaaataggccacacacaggtcgacccgtatgggaaacgctgttattgcggg
aatcacggttgcctcgaaaccatcgccagtgtggacagtattcttgagctggcacagctg
cgtctcaatcaatccatgagctcgatgttacatggacaaccgttaaccgtggactcattg
tgtcaggcggcattgcgcggcgatctactggcaaaagacatcattaccggggtaggcgcg
catgtcggtcgcattcttgccatcatggtgaatttatttaacccacaaaaaatactgatt
ggctcaccgttaagtaaagcggcagatatcctcttcccagtcatctcggacagcatccgt
cagcaggcccttcctgcgtatagtcagcacattagcgttgagagtactcagttttctaac
cagggcacgatggcaggcgctgcgctggtaaaagacgcgatgtataacggttctttgttg
attcgtctgttgcagggttaa

DBGET integrated database retrieval system