KEGG   Escherichia coli O6 K2 H1 CFT073 (UPEC): c1998Help
Entry
c1998             CDS       T00106                                 

Gene name
ydgB
Definition
short chain dehydrogenase (EC:1.-.-.-)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ecc  Escherichia coli O6:K2:H1 CFT073 (UPEC)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    c1998 (ydgB)
   00670 One carbon pool by folate
    c1998 (ydgB)
Enzymes [BR:ecc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     c1998 (ydgB)
    1.5.1.-  
     c1998 (ydgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1841671..1842393
Genome map
AA seq 240 aa AA seqDB search
MGKTQSLPILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLIKAGAQCIQADFS
TNDGVMAFADEVLKSTHGLRAILHNASAWMAEKPGAPLTDVLACMMQIHVNTPYLLNHAL
ERLLRGHGHAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIA
PSLILFNEHDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSLPLDGGRHLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaacccagtccttgccaatattaattactggcggaggtcgccgcatcggcctc
gccctcgcatggcatttcattaatcaaaagcaaccggtgattgtcagctatcggacgcac
tatcccgccattgatggactgattaaggcaggtgcgcagtgtattcaggctgatttttcg
accaacgacggtgtgatggcgtttgccgatgaagtactaaaaagcacccatggtctgcgt
gctattttgcataacgccagcgcgtggatggcggaaaaaccgggagcgccactgaccgac
gtactggcttgcatgatgcagatccacgttaataccccatacctgctcaaccatgctctg
gaaagattactgcgtgggcacggacacgccgccagcgatatcattcactttaccgattat
gtggtggagcgcggtagcgacaaacatattgcgtatgctgcaagcaaagcggcactggat
aatatgacccgctcgtttgcccgcaagctggcaccggaagtgaaagtgaattctattgcg
ccatcgctgatcctgtttaatgaacatgatgatgctgaatatcgacaacaggcgctgaat
aaatcactgatgaaaaccgcgcctggcgagaaagaagtgatcgacctggtcgattactta
cttaccagctgctttgtcaccggacgcagtctcccacttgatggcggtcgtcatctgcgt
taa

DBGET integrated database retrieval system